KLRK1 (killer cell lectin like receptor K1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22914
Gene name Gene Name - the full gene name approved by the HGNC.
Killer cell lectin like receptor K1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLRK1
Synonyms (NCBI Gene) Gene synonyms aliases
CD314, D12S2489E, KLR, NKG2-D, NKG2D
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(24)
miRTarBase ID miRNA Experiments Reference
MIRT017175 hsa-miR-335-5p Microarray 18185580
MIRT019249 hsa-miR-148b-3p Microarray 17612493
MIRT021363 hsa-miR-9-5p Microarray 17612493
MIRT1099411 hsa-miR-103b CLIP-seq
MIRT1099412 hsa-miR-1236 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
ATM Activation 19767562
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0005515 Function Protein binding IPI 10426993, 10426994, 11323699, 11754823, 15240696, 18544572, 19424970, 19436053, 19658097, 21712812, 23696226, 28559451, 32296183
GO:0005886 Component Plasma membrane IDA 17562706
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane TAS 2007850
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
611817 18788 ENSG00000213809
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P26718
Protein name NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)
Protein function Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory
PDB 1HYR , 1KCG , 1MPU , 4PDC , 4S0U , 8TM0 , 8TM2 , 9DH2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 116 → 213 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs). {ECO:00002
Sequence 
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Sequence length 216
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Natural killer cell mediated cytotoxicity
Malaria 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
DAP12 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 17295095
Show/Hide Text Mining Associations (205)
Associations from Text Mining
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 21806677
Acute Disease Associate 30949182
Acute Lung Injury Associate 37878820
Addison Disease Associate 28223394
Adenocarcinoma of Lung Associate 25966072, 35132098
Alopecia Areata Associate 18160967, 30558329
Alzheimer Disease Stimulate 33101276
Ameloblastoma Associate 39289711
Anemia Aplastic Associate 19594748, 39337644
Anemia Aplastic Stimulate 30907293