Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	22914
Gene name	Killer cell lectin like receptor K1
Gene symbol	KLRK1
Synonyms (NCBI Gene)	CD314D12S2489EKLRNKG2-DNKG2D
Chromosome	12
Chromosome location	12p13.2
Summary	Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci

Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017175	hsa-miR-335-5p	Microarray	18185580
MIRT019249	hsa-miR-148b-3p	Microarray	17612493
MIRT021363	hsa-miR-9-5p	Microarray	17612493
MIRT1099411	hsa-miR-103b	CLIP-seq
MIRT1099412	hsa-miR-1236	CLIP-seq
MIRT1099413	hsa-miR-205	CLIP-seq
MIRT1099414	hsa-miR-331-3p	CLIP-seq
MIRT1099415	hsa-miR-4292	CLIP-seq
MIRT1099416	hsa-miR-4420	CLIP-seq
MIRT1099417	hsa-miR-4496	CLIP-seq
MIRT1099418	hsa-miR-4753-3p	CLIP-seq
MIRT1099419	hsa-miR-548p	CLIP-seq
MIRT1099420	hsa-miR-942	CLIP-seq
MIRT2026962	hsa-miR-124	CLIP-seq
MIRT2026963	hsa-miR-4641	CLIP-seq
MIRT2026964	hsa-miR-4711-3p	CLIP-seq
MIRT2026965	hsa-miR-506	CLIP-seq
MIRT2026966	hsa-miR-593	CLIP-seq
MIRT2026967	hsa-miR-649	CLIP-seq
MIRT2452710	hsa-miR-1291	CLIP-seq
MIRT2452711	hsa-miR-3173-5p	CLIP-seq
MIRT2452712	hsa-miR-328	CLIP-seq
MIRT2026963	hsa-miR-4641	CLIP-seq
MIRT2452713	hsa-miR-663b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ATM	Activation	19767562

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	10426993, 10426994, 11323699, 11754823, 15240696, 18544572, 19424970, 19436053, 19658097, 21712812, 23696226, 28559451, 32296183
GO:0005886	Component	Plasma membrane	IDA	17562706
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2007850
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	2007850
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	10426994, 15294961
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9683661
GO:0030101	Process	Natural killer cell activation	IEA
GO:0030101	Process	Natural killer cell activation	IEA
GO:0030101	Process	Natural killer cell activation	TAS	18676862
GO:0030154	Process	Cell differentiation	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031295	Process	T cell costimulation	TAS	18676862
GO:0032394	Function	MHC class Ib receptor activity	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0034260	Process	Negative regulation of GTPase activity	IDA	22585739
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IDA	17562706
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038023	Function	Signaling receptor activity	TAS	2007850
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	16582911
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	17562706
GO:0042288	Function	MHC class I protein binding	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IBA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	15294961
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0098542	Process	Defense response to other organism	IEA
GO:2000502	Process	Negative regulation of natural killer cell chemotaxis	IDA	22585739

MIM	HGNC	e!Ensembl
611817	18788	ENSG00000213809

P26718

Protein name

NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)

Protein function

Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory

PDB

1HYR , 1KCG , 1MPU , 4PDC , 4S0U , 8TM0 , 8TM2 , 9DH2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	116 → 213	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs). {ECO:00002

Sequence

MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Sequence length

216

Interactions

View interactions

	KEGG		Reactome
	Natural killer cell mediated cytotoxicity Malaria		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell DAP12 signaling

KLRK1 (killer cell lectin like receptor K1)