Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22914
Gene name Gene Name - the full gene name approved by the HGNC.
Killer cell lectin like receptor K1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLRK1
Synonyms (NCBI Gene) Gene synonyms aliases
CD314, D12S2489E, KLR, NKG2-D, NKG2D
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017175 hsa-miR-335-5p Microarray 18185580
MIRT019249 hsa-miR-148b-3p Microarray 17612493
MIRT021363 hsa-miR-9-5p Microarray 17612493
MIRT1099411 hsa-miR-103b CLIP-seq
MIRT1099412 hsa-miR-1236 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ATM Activation 19767562
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 10426993, 10426994, 11323699, 11754823, 15240696, 18544572, 19424970, 19436053, 19658097, 21712812, 23696226, 28559451, 32296183
GO:0005886 Component Plasma membrane IDA 17562706
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611817 18788 ENSG00000213809
Protein
UniProt ID P26718
Protein name NKG2-D type II integral membrane protein (Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)
Protein function Functions as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory
PDB 1HYR , 1KCG , 1MPU , 4PDC , 4S0U , 8TM0 , 8TM2 , 9DH2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 116 213 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs). {ECO:00002
Sequence
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQ
RTV
Sequence length 216
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Natural killer cell mediated cytotoxicity
Malaria
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
DAP12 signaling
<