Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	22899
Gene name Gene Name - the full gene name approved by the HGNC.	Rho guanine nucleotide exchange factor 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ARHGEF15
Synonyms (NCBI Gene) Gene synonyms aliases	ARGEF15, E5, Ephexin5, Vsm-RhoGEF
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein-coupled receptors. This gene encodes a protein that functions as a specific guanine nucleotide exchange factor for R

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1555546796	GTCCCCCGTCGGGCC>-	Likely-pathogenic	Inframe deletion, genic upstream transcript variant, upstream transcript variant, coding sequence variant

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments
MIRT795517	hsa-miR-3064-5p	CLIP-seq
MIRT795518	hsa-miR-3176	CLIP-seq
MIRT795519	hsa-miR-3652	CLIP-seq
MIRT795520	hsa-miR-3922-3p	CLIP-seq
MIRT795521	hsa-miR-4420	CLIP-seq
MIRT795522	hsa-miR-4430	CLIP-seq
MIRT795523	hsa-miR-4459	CLIP-seq
MIRT795524	hsa-miR-4505	CLIP-seq
MIRT795525	hsa-miR-665	CLIP-seq
MIRT795526	hsa-miR-892b	CLIP-seq
MIRT1934895	hsa-miR-1253	CLIP-seq
MIRT1934896	hsa-miR-1299	CLIP-seq
MIRT1934897	hsa-miR-3074-5p	CLIP-seq
MIRT1934898	hsa-miR-3182	CLIP-seq
MIRT1934899	hsa-miR-370	CLIP-seq
MIRT1934900	hsa-miR-4511	CLIP-seq
MIRT1934901	hsa-miR-4659a-3p	CLIP-seq
MIRT1934902	hsa-miR-4659b-3p	CLIP-seq
MIRT1934903	hsa-miR-4691-3p	CLIP-seq
MIRT1934904	hsa-miR-4782-5p	CLIP-seq
MIRT1934905	hsa-miR-516b	CLIP-seq
MIRT1934906	hsa-miR-7	CLIP-seq
MIRT1934907	hsa-miR-767-3p	CLIP-seq
MIRT1934908	hsa-miR-875-3p	CLIP-seq
MIRT795526	hsa-miR-892b	CLIP-seq
MIRT2174676	hsa-miR-2467-5p	CLIP-seq
MIRT2174677	hsa-miR-3188	CLIP-seq
MIRT2174678	hsa-miR-3929	CLIP-seq
MIRT2174679	hsa-miR-3975	CLIP-seq
MIRT2174680	hsa-miR-4419b	CLIP-seq
MIRT2174681	hsa-miR-4478	CLIP-seq
MIRT2174682	hsa-miR-4649-3p	CLIP-seq
MIRT2174683	hsa-miR-485-5p	CLIP-seq
MIRT2478121	hsa-miR-3688-3p	CLIP-seq
MIRT2478122	hsa-miR-3923	CLIP-seq
MIRT2478123	hsa-miR-4261	CLIP-seq
MIRT795525	hsa-miR-665	CLIP-seq
MIRT2675305	hsa-miR-1273g	CLIP-seq
MIRT2675306	hsa-miR-1286	CLIP-seq
MIRT2675307	hsa-miR-4722-5p	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	12775584
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	ISS
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	12775584, 25416956, 26871637, 32296183
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0042995	Component	Cell projection	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS
GO:0061299	Process	Retina vasculature morphogenesis in camera-type eye	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA
GO:2000297	Process	Negative regulation of synapse maturation	IEA
GO:2000297	Process	Negative regulation of synapse maturation	ISS

MIM	HGNC	e!Ensembl
608504	15590	ENSG00000198844

Protein

UniProt ID

O94989

Protein name

Rho guanine nucleotide exchange factor 15 (Ephexin-5) (E5) (Vsm-RhoGEF)

Protein function

Specific GEF for RhoA activation. Does not activate RAC1 or CDC42. Regulates vascular smooth muscle contractility. Negatively regulates excitatory synapse development by suppressing the synapse-promoting activity of EPHB2. {ECO:0000269|PubMed:12

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00621	RhoGEF	421 → 599	RhoGEF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the vascular smooth muscle of coronary artery. {ECO:0000269|PubMed:12775584}.

Sequence

MSAQSLPAATPPTQKPPRIIRPRPPSRSRAAQSPGPPHNGSSPQELPRNSNDAPTPMCTP
IFWEPPAASLKPPALLPPSASRASLDSQTSPDSPSSTPTPSPVSRRSASPEPAPRSPVPP
PKPSGSPCTPLLPMAGVLAQNGSASAPGTVRRLAGRFEGGAEGRAQDADAPEPGLQARAD
VNGEREAPLTGSGSQENGAPDAGLACPPCCPCVCHTTRPGLELRWVPVGGYEEVPRVPRR
ASPLRTSRSRPHPPSIGHPAVVLTSYRSTAERKLLPLLKPPKPTRVRQDATIFGDPPQPD
LDLLSEDGIQTGDSPDEAPQNTPPATVEGREEEGLEVLKEQNWELPLQDEPLYQTYRAAV
LSEELWGVGEDGSPSPANAGDAPTFPRPPGPRNTLWQELPAVQASGLLDTLSPQERRMQE
SLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLATLL
SRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQS
LPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALGAVSKIIERCSA
EVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLEFQGELTELGCRRGGVLFASRPRFT
PLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRPT
HRLLQASSLSDMQRWLGAFPTPGPLPCSPDTIYEDCDCSQELCSESSAPAKTEGRSLESR
AAPKHLHKTPEGWLKGLPGAFPAQLVCEVTGEHERRRHLRQNQRLLEAVGSSSGTPNAPP
P

Sequence length

841

Interactions

View interactions

	Reactome
			NRAGE signals death through JNK Rho GTPase cycle G alpha (12/13) signalling events

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Epileptic Encephalopathy	early infantile epileptic encephalopathy with suppression bursts	rs1555546796	N/A

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Developmental And Epileptic Encephalopathy	genetic developmental and epileptic encephalopathy	N/A	N/A	GenCC
Uterine Fibroids	Uterine fibroids	N/A	N/A	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Pancreatic Ductal	Stimulate	27145964
Epilepsy Rolandic	Associate	29789371
Neoplasms	Associate	27145964
Pancreatic Neoplasms	Associate	27145964
Polypoidal Choroidal Vasculopathy	Associate	29789371

ARHGEF15 (Rho guanine nucleotide exchange factor 15)