Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22895
Gene name Gene Name - the full gene name approved by the HGNC.
Rabphilin 3A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RPH3A
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.13
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is thought to be an effector for RAB3A, which is a small G protein that acts in the late stages of neurotransmitter exocytosis. The encoded protein may be involved in neurotransmitter release and synaptic vesicle traffic.
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs779991033 G>C Pathogenic Genic upstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048316 hsa-miR-106a-5p CLASH 23622248
MIRT654140 hsa-miR-3177-5p HITS-CLIP 21572407
MIRT654139 hsa-miR-6867-5p HITS-CLIP 21572407
MIRT707181 hsa-miR-124-5p HITS-CLIP 21572407
MIRT654138 hsa-miR-4666a-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding ISS
GO:0005515 Function Protein binding IPI 11377421, 15207266, 32296183
GO:0005544 Function Calcium-dependent phospholipid binding ISS
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding ISS
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612159 17056 ENSG00000089169
Protein
UniProt ID Q9Y2J0
Protein name Rabphilin-3A (Exophilin-1)
Protein function Plays an essential role in docking and fusion steps of regulated exocytosis (By similarity). At the presynaptic level, RPH3A is recruited by RAB3A to the synaptic vesicle membrane in a GTP-dependent manner where it modulates synaptic vesicle tra
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02318 FYVE_2 48 161 FYVE-type zinc finger Family
PF00168 C2 407 516 C2 domain Domain
PF00168 C2 565 671 C2 domain Domain
Sequence
MTDTVFSNSSNRWMYPSDRPLQSNDKEQLQAGWSVHPGGQPDRQRKQEELTDEEKEIINR
VIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKK
NVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGF
PKQVLPQPMPIKKTKPQQP
VSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEAR
MSSSSRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTPGGS
RPGPGPAGRFPDQKPEVAPSDPGTTAPPREERTGGVGGYPAVGAREDRMSHPSGPYSQAS
AAAPQPAAARQPPPPEEEEEEANSYDSDEATTLGALEFSLLYDQDNSSLQCTIIKAKGLK
PMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRI
SVCDEDKFGHNEFIGETRFSLKKLKPNQRKNFNICL
ERVIPMKRAGTTGSARGMALYEEE
QVERVGDIEERGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGK
KAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISA
KGERLKHWYEC
LKNKDKKIERWHQLQNENHVSSD
Sequence length 694
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Epilepsy Epilepsy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Huntington Disease Associate 17877635
Learning Disabilities Associate 29441694
Myasthenic Syndromes Congenital Associate 29441694
Nervous System Diseases Associate 29441694
Neuromuscular Junction Diseases Associate 29441694