Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22891
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 365
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF365
Synonyms (NCBI Gene) Gene synonyms aliases
Su48, UAN, ZNF365D
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a zinc finger protein that may play a role in the repair of DNA damage and maintenance of genome stability. The N-terminal C2H2 zinc finger motif is required to form a protein complex with PARP1 and MRE11, which are known to be involved
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016433 hsa-miR-193b-3p Microarray 20304954
MIRT025758 hsa-miR-7-5p Microarray 17612493
MIRT437691 hsa-miR-223-3p Microarray, qRT-PCR 22815788
MIRT1523164 hsa-miR-1299 CLIP-seq
MIRT1523165 hsa-miR-3182 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000281 Process Mitotic cytokinesis IMP 16617106
GO:0000723 Process Telomere maintenance IBA
GO:0000723 Process Telomere maintenance IEA
GO:0000723 Process Telomere maintenance IMP 23776040
GO:0005515 Function Protein binding IPI 16682949, 17389905, 23966166
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607818 18194 ENSG00000138311
Protein
UniProt ID Q70YC4
Protein name Talanin
Protein function May play a role in uric acid excretion.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 4 is expressed in placenta, lung, kidney and pancreas. {ECO:0000269|PubMed:12740763}.
Sequence
MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKSTHLKKPLMKQAPPWKDH
LTFQPLHPAERKTQVWRWQSGNSSDLETTSSASPWPTGSNRDVVLNTLAESCCGLSELIT
APPYAGVSIQGFSQIWVLFPFCGGTFHHNEKDVLGLQDFERESVSTSQSRNISLLTLGQL
QNCVIGKLTIIDLLTEHLLGVRHGVICFPWGLPSSS
Sequence length 216
UniProt ID Q70YC5
Protein name Protein ZNF365 (DISC1-binding zinc-finger protein) (Protein su48)
Protein function Involved in the regulation of neurogenesis. Negatively regulates neurite outgrowth (PubMed:17389905). Involved in the morphogenesis of basket cells in the somatosensory cortex during embryogenesis. Involved in the positive regulation of oligoden
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is expressed in brain. Isoform 2 is expressed in placenta and at low level in lung and liver. Isoform 3 is expressed in kidney and pancreas. Isoform 1 is expressed exclusively in brain (PubMed:17389905). {ECO:0000269|PubMed:1
Sequence
MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLT
KCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAE
RPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRI
DKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESE
EELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGF
VRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPA
KAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII
Sequence length 407
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast cancer Breast cancer (estrogen-receptor negative), Breast cancer N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aneuploidy Inhibit 23776040
Breast Carcinoma In Situ Associate 24743323
Breast Neoplasms Associate 21060860, 21908515, 22348646, 22351618, 22747683, 24528085, 24722754, 24743323, 25329322, 25862352, 26036842, 26073781, 27863437, 38094285
Colitis Ulcerative Associate 21818367, 21830272
Colonic Diseases Associate 21830272
Crohn Disease Associate 21257989, 21818367, 21830272, 25489960, 28300425, 30500874
Death Sudden Cardiac Associate 23593153
Disease Associate 21853134
Inflammation Associate 28300425
Narcolepsy Associate 24204295