Gene Gene information from NCBI Gene database.
Entrez ID 2288
Gene name FKBP prolyl isomerase 4
Gene symbol FKBP4
Synonyms (NCBI Gene)
FKBP51FKBP52FKBP59HBIHsp56PPIasep52
Chromosome 12
Chromosome location 12p13.33
Summary The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds
miRNA miRNA information provided by mirtarbase database.
421
miRTarBase ID miRNA Experiments Reference
MIRT050423 hsa-miR-23a-3p CLASH 23622248
MIRT049584 hsa-miR-92a-3p CLASH 23622248
MIRT048140 hsa-miR-197-3p CLASH 23622248
MIRT045461 hsa-miR-149-5p CLASH 23622248
MIRT045461 hsa-miR-149-5p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
AR Unknown 23192983
HSF1 Unknown 20692357
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
52
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0003755 Function Peptidyl-prolyl cis-trans isomerase activity IBA
GO:0003755 Function Peptidyl-prolyl cis-trans isomerase activity IDA 11350175
GO:0003755 Function Peptidyl-prolyl cis-trans isomerase activity IEA
GO:0005515 Function Protein binding IPI 11583998, 12604780, 14638689, 19875381, 20133804, 20188096, 21170051, 21360678, 21730179, 23741051, 25036637, 25277244, 28514442, 32296183, 33961781, 35063084
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600611 3720 ENSG00000004478
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q02790
Protein name Peptidyl-prolyl cis-trans isomerase FKBP4 (PPIase FKBP4) (EC 5.2.1.8) (51 kDa FK506-binding protein) (FKBP51) (52 kDa FK506-binding protein) (52 kDa FKBP) (FKBP-52) (59 kDa immunophilin) (p59) (FK506-binding protein 4) (FKBP-4) (FKBP59) (HSP-binding immun
Protein function Immunophilin protein with PPIase and co-chaperone activities. Component of steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). May play a role in the intracellular trafficking of heterooligomeric forms of st
PDB 1N1A , 1P5Q , 1Q1C , 1QZ2 , 4DRJ , 4LAV , 4LAW , 4LAX , 4LAY , 4TW8 , 6RCY , 8FFV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00254 FKBP_C 43 135 FKBP-type peptidyl-prolyl cis-trans isomerase Domain
PF00254 FKBP_C 160 250 FKBP-type peptidyl-prolyl cis-trans isomerase Domain
PF00515 TPR_1 320 352 Tetratricopeptide repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:1279700}.
Sequence
MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPP
KIPPNATLVFEVELF
EFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKD
KLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPN
AELKYELHLK
SFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWL
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE
EENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA
Sequence length 459
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Estrogen signaling pathway   HSP90 chaperone cycle for steroid hormone receptors (SHR)
Attenuation phase
ESR-mediated signaling
Estrogen-dependent gene expression
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
FKBP4-related disorder Uncertain significance rs775815627 RCV003397368
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37335089
Androgen Insensitivity Syndrome Associate 33182400
Behcet Syndrome Associate 39278467
Breast Neoplasms Associate 19228724, 24927296, 32814092, 35394865
Cap Myopathy Associate 28852180
Carcinoma Associate 31467233
Carcinoma Non Small Cell Lung Stimulate 33354489
Colorectal Neoplasms Associate 15004035
Depressive Disorder Major Associate 19199039, 20726698
Disorders of Sex Development Associate 33182400