Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	22854
Gene name	Netrin G1
Gene symbol	NTNG1
Synonyms (NCBI Gene)	Lmnt1NetG1NetrinG1
Chromosome	1
Chromosome location	1p13.3
Summary	This gene encodes a preproprotein that is processed into a secreted protein containing eukaroytic growth factor (EGF)-like domains. This protein acts to guide axon growth during neuronal development. Polymorphisms in this gene may be associated with schiz

Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029912	hsa-miR-26b-5p	Microarray	19088304
MIRT1196182	hsa-miR-583	CLIP-seq
MIRT1196183	hsa-miR-22	CLIP-seq
MIRT1196184	hsa-miR-3135b	CLIP-seq
MIRT1196185	hsa-miR-338-5p	CLIP-seq
MIRT1196186	hsa-miR-3652	CLIP-seq
MIRT1196187	hsa-miR-3689d	CLIP-seq
MIRT1196188	hsa-miR-421	CLIP-seq
MIRT1196189	hsa-miR-4430	CLIP-seq
MIRT1196190	hsa-miR-4474-3p	CLIP-seq
MIRT1196191	hsa-miR-4505	CLIP-seq
MIRT1196192	hsa-miR-4709-5p	CLIP-seq
MIRT1196193	hsa-miR-511	CLIP-seq
MIRT1196194	hsa-miR-644	CLIP-seq
MIRT1196195	hsa-miR-889	CLIP-seq
MIRT2056947	hsa-miR-3127-5p	CLIP-seq
MIRT2056948	hsa-miR-3202	CLIP-seq
MIRT2056949	hsa-miR-4533	CLIP-seq
MIRT2686662	hsa-miR-133a	CLIP-seq
MIRT2686663	hsa-miR-133b	CLIP-seq
MIRT2686664	hsa-miR-3163	CLIP-seq
MIRT2686665	hsa-miR-3662	CLIP-seq
MIRT2686666	hsa-miR-4486	CLIP-seq
MIRT1196182	hsa-miR-583	CLIP-seq
MIRT2686667	hsa-miR-603	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14595443, 21946559, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007409	Process	Axonogenesis	ISS
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0048787	Component	Presynaptic active zone membrane	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050839	Function	Cell adhesion molecule binding	IPI	23986473
GO:0098552	Component	Side of membrane	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	IGI	23986473
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099560	Process	Synaptic membrane adhesion	IEA
GO:0099560	Process	Synaptic membrane adhesion	IGI	23986473
GO:0150011	Process	Regulation of neuron projection arborization	IEA
GO:0150011	Process	Regulation of neuron projection arborization	ISS
GO:2001222	Process	Regulation of neuron migration	IEA
GO:2001222	Process	Regulation of neuron migration	ISS

MIM	HGNC	e!Ensembl
608818	23319	ENSG00000162631

Q9Y2I2

Protein name

Netrin-G1 (Laminet-1)

Protein function

Involved in controlling patterning and neuronal circuit formation at the laminar, cellular, subcellular and synaptic levels. Promotes neurite outgrowth of both axons and dendrites.

PDB

3ZYJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00055	Laminin_N	50 → 295	Laminin N-terminal (Domain VI)	Family
PF00053	Laminin_EGF	297 → 343	Laminin EGF domain	Domain
PF00053	Laminin_EGF	364 → 417	Laminin EGF domain	Domain
PF00053	Laminin_EGF	420 → 467	Laminin EGF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the thalamus, with very low expression, if any, in other tissues. {ECO:0000269|PubMed:14595443, ECO:0000269|PubMed:15901489}.

Sequence

MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF

Sequence length

539

Interactions

View interactions

	KEGG		Reactome
	Axon guidance Cell adhesion molecules		Post-translational modification: synthesis of GPI-anchored proteins

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
NTNG1-related disorder	Likely benign; Benign	rs199902525, rs201741317, rs142977353, rs151288291, rs143347360, rs144330931	RCV003981189 RCV003969307 RCV003952262 RCV003955936 RCV003958354 RCV003977978
See cases	Uncertain significance	rs1675209293	RCV001196776

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Anorexia Nervosa	Associate	27483138
Autism Spectrum Disorder	Associate	22495309
Autistic Disorder	Associate	22495309
Carcinogenesis	Associate	28257124
Carcinogenesis	Inhibit	33127842
Carcinoma Ovarian Epithelial	Associate	33246661
Carcinoma Pancreatic Ductal	Associate	33127842
Celiac Disease	Associate	27483138
COVID 19	Associate	32503822
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	19296131
Diabetic Nephropathies	Associate	31895808
Glomerulonephritis Membranous	Associate	35985817
Intracranial Arteriosclerosis	Associate	34073619
Neoplasms	Associate	28257124, 32251318, 33127842
Ovarian Neoplasms	Inhibit	39972314
Pancreatitis	Associate	33127842
Polyps	Associate	28257124
Prostatic Neoplasms	Associate	36045381
Psychomotor Disorders	Associate	19296131
Rett Syndrome	Associate	16502428
Seizures	Associate	16502428

NTNG1 (netrin G1)