ZNF652 (zinc finger protein 652)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22834
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 652
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF652
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32-q21.33
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2713)
miRTarBase ID miRNA Experiments Reference
MIRT000975 hsa-miR-155-5p Luciferase reporter assay 18367535
MIRT000975 hsa-miR-155-5p Luciferase reporter assay 18367535
MIRT000975 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT021105 hsa-miR-186-5p Sequencing 20371350
MIRT021763 hsa-miR-132-3p Microarray 17612493
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
CBFA2T3 Repression 20116376
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16966434
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613907 29147 ENSG00000198740
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9Y2D9
Protein name Zinc finger protein 652
Protein function Functions as a transcriptional repressor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 245 → 268 Zinc finger, C2H2 type Domain
PF12874 zf-met 329 → 351 Domain
PF00096 zf-C2H2 357 → 379 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 385 → 407 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 441 → 463 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with higher expression in breast, prostate, vulva and pancreas. {ECO:0000269|PubMed:16966434}.
Sequence 
MSHTASSCQELVENCAVHVAGMAQEDSRRGQVPSSFYHGANQELDLSTKVYKRESGSPYS
VLVDTKMSKPHLHETEEQPYFRETRAVSDVHAVKEDRENSDDTEEEEEEVSYKREQIIVE
VNLNNQTLNVSKGEKGVSSQSKETPVLKTSSEEEEEESEEEATDDSNDYGENEKQKKKEK
IVEKVSVTQRRTRRAASVAAATTSPTPRTTRGRRKSVEPPKRKKRATKEPKAPVQKAKCE
EKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESELSLHQQTDCEKNIQ
CVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVAHTKDMPFTCE
TCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHIGHKQFMCQWCGK
DFNMKQYFDEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRF
SNMLKAHKEKCFRVTSPVNVPPAVQIPLTTSPATPVPSVVNTATTPTPPINMNPVSTLPP
RPIPHPFSHLHIHPHPHHPHHLPIPPVPHLPPPPALFKSEPLNHRGQSEDNFLRHLAEKN
SSAQHH
Sequence length 606
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (17)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or gastroesophageal reflux disease, Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Asthma Age of onset of childhood onset asthma, Age of onset of adult onset asthma, Asthma (childhood onset), Asthma (moderate or severe), Asthma in any disease, Nonatopic asthma, Atopic asthma, Asthma (adult onset), Pediatric asthma, Asthma N/A N/A GWAS
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Show/Hide Text Mining Associations (16)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 39201500
Breast Neoplasms Associate 37906592
Carcinogenesis Associate 35258403
Coronary Artery Disease Associate 39201500
Dermatitis Atopic Associate 29489655
Diabetic Nephropathies Associate 32778679
Egg Hypersensitivity Associate 29489655
Food Hypersensitivity Associate 29489655
Glioblastoma Associate 35258403
Hypertension Associate 19430483