Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	22809
Gene name Gene Name - the full gene name approved by the HGNC.	Activating transcription factor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ATF5
Synonyms (NCBI Gene) Gene synonyms aliases	ATFX, HMFN0395
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33

Show/Hide all(182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025724	hsa-miR-7-5p	Microarray	19073608
MIRT046831	hsa-miR-222-3p	CLASH	23622248
MIRT716538	hsa-miR-6856-3p	HITS-CLIP	19536157
MIRT716537	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT716536	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT716535	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT716534	hsa-miR-5695	HITS-CLIP	19536157
MIRT716533	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT716532	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT716531	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT151995	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT151995	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT735195	hsa-miR-520b	Luciferase reporter assay, qRT-PCR	32603335
MIRT716538	hsa-miR-6856-3p	HITS-CLIP	19536157
MIRT716537	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT716536	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT716535	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT716534	hsa-miR-5695	HITS-CLIP	19536157
MIRT716533	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT716532	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT716531	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT804283	hsa-miR-106a	CLIP-seq
MIRT804284	hsa-miR-106b	CLIP-seq
MIRT804285	hsa-miR-1182	CLIP-seq
MIRT804286	hsa-miR-1185	CLIP-seq
MIRT804287	hsa-miR-1250	CLIP-seq
MIRT804288	hsa-miR-141	CLIP-seq
MIRT804289	hsa-miR-150	CLIP-seq
MIRT804290	hsa-miR-17	CLIP-seq
MIRT804291	hsa-miR-1912	CLIP-seq
MIRT804292	hsa-miR-192	CLIP-seq
MIRT804293	hsa-miR-193a-5p	CLIP-seq
MIRT804294	hsa-miR-1976	CLIP-seq
MIRT804295	hsa-miR-200a	CLIP-seq
MIRT804296	hsa-miR-20a	CLIP-seq
MIRT804297	hsa-miR-20b	CLIP-seq
MIRT804298	hsa-miR-2115	CLIP-seq
MIRT804299	hsa-miR-215	CLIP-seq
MIRT804300	hsa-miR-2861	CLIP-seq
MIRT804301	hsa-miR-302a	CLIP-seq
MIRT804302	hsa-miR-302b	CLIP-seq
MIRT804303	hsa-miR-302c	CLIP-seq
MIRT804304	hsa-miR-302d	CLIP-seq
MIRT804305	hsa-miR-302e	CLIP-seq
MIRT804306	hsa-miR-3130-3p	CLIP-seq
MIRT804307	hsa-miR-3150a-5p	CLIP-seq
MIRT804308	hsa-miR-3150b-5p	CLIP-seq
MIRT804309	hsa-miR-3161	CLIP-seq
MIRT804310	hsa-miR-3173-3p	CLIP-seq
MIRT804311	hsa-miR-339-5p	CLIP-seq
MIRT804312	hsa-miR-3613-3p	CLIP-seq
MIRT804313	hsa-miR-3673	CLIP-seq
MIRT804314	hsa-miR-3679-5p	CLIP-seq
MIRT804315	hsa-miR-372	CLIP-seq
MIRT804316	hsa-miR-373	CLIP-seq
MIRT804317	hsa-miR-3945	CLIP-seq
MIRT804318	hsa-miR-3976	CLIP-seq
MIRT804319	hsa-miR-4252	CLIP-seq
MIRT804320	hsa-miR-4258	CLIP-seq
MIRT804321	hsa-miR-4265	CLIP-seq
MIRT804322	hsa-miR-4296	CLIP-seq
MIRT804323	hsa-miR-4312	CLIP-seq
MIRT804324	hsa-miR-4322	CLIP-seq
MIRT804325	hsa-miR-4417	CLIP-seq
MIRT804326	hsa-miR-4423-5p	CLIP-seq
MIRT804327	hsa-miR-4428	CLIP-seq
MIRT804328	hsa-miR-4501	CLIP-seq
MIRT804329	hsa-miR-4533	CLIP-seq
MIRT804330	hsa-miR-4638-5p	CLIP-seq
MIRT804331	hsa-miR-4683	CLIP-seq
MIRT804332	hsa-miR-4687-3p	CLIP-seq
MIRT804333	hsa-miR-4722-3p	CLIP-seq
MIRT804334	hsa-miR-4731-5p	CLIP-seq
MIRT804335	hsa-miR-4747-5p	CLIP-seq
MIRT804336	hsa-miR-4757-5p	CLIP-seq
MIRT804337	hsa-miR-4774-5p	CLIP-seq
MIRT804338	hsa-miR-4779	CLIP-seq
MIRT804339	hsa-miR-4781-3p	CLIP-seq
MIRT804340	hsa-miR-512-3p	CLIP-seq
MIRT804341	hsa-miR-516a-3p	CLIP-seq
MIRT804342	hsa-miR-519d	CLIP-seq
MIRT804343	hsa-miR-520a-3p	CLIP-seq
MIRT804344	hsa-miR-520c-3p	CLIP-seq
MIRT804345	hsa-miR-520d-3p	CLIP-seq
MIRT804346	hsa-miR-520e	CLIP-seq
MIRT804347	hsa-miR-520g	CLIP-seq
MIRT804348	hsa-miR-520h	CLIP-seq
MIRT804349	hsa-miR-548c-3p	CLIP-seq
MIRT804350	hsa-miR-550b	CLIP-seq
MIRT804351	hsa-miR-610	CLIP-seq
MIRT804352	hsa-miR-633	CLIP-seq
MIRT804353	hsa-miR-670	CLIP-seq
MIRT804354	hsa-miR-93	CLIP-seq
MIRT804355	hsa-miR-941	CLIP-seq
MIRT804356	hsa-miR-1178	CLIP-seq
MIRT804357	hsa-miR-129-5p	CLIP-seq
MIRT804288	hsa-miR-141	CLIP-seq
MIRT804289	hsa-miR-150	CLIP-seq
MIRT804295	hsa-miR-200a	CLIP-seq
MIRT804358	hsa-miR-3130-5p	CLIP-seq
MIRT804307	hsa-miR-3150a-5p	CLIP-seq
MIRT804308	hsa-miR-3150b-5p	CLIP-seq
MIRT804310	hsa-miR-3173-3p	CLIP-seq
MIRT804312	hsa-miR-3613-3p	CLIP-seq
MIRT804359	hsa-miR-3646	CLIP-seq
MIRT804360	hsa-miR-3662	CLIP-seq
MIRT804320	hsa-miR-4258	CLIP-seq
MIRT804361	hsa-miR-433	CLIP-seq
MIRT804362	hsa-miR-4482	CLIP-seq
MIRT804363	hsa-miR-4520b-3p	CLIP-seq
MIRT804364	hsa-miR-4529-3p	CLIP-seq
MIRT804365	hsa-miR-4704-3p	CLIP-seq
MIRT804366	hsa-miR-4804-5p	CLIP-seq
MIRT804349	hsa-miR-548c-3p	CLIP-seq
MIRT804351	hsa-miR-610	CLIP-seq
MIRT804283	hsa-miR-106a	CLIP-seq
MIRT804284	hsa-miR-106b	CLIP-seq
MIRT804289	hsa-miR-150	CLIP-seq
MIRT804290	hsa-miR-17	CLIP-seq
MIRT804294	hsa-miR-1976	CLIP-seq
MIRT804296	hsa-miR-20a	CLIP-seq
MIRT804297	hsa-miR-20b	CLIP-seq
MIRT804301	hsa-miR-302a	CLIP-seq
MIRT804302	hsa-miR-302b	CLIP-seq
MIRT804303	hsa-miR-302c	CLIP-seq
MIRT804304	hsa-miR-302d	CLIP-seq
MIRT804305	hsa-miR-302e	CLIP-seq
MIRT804309	hsa-miR-3161	CLIP-seq
MIRT804310	hsa-miR-3173-3p	CLIP-seq
MIRT1937526	hsa-miR-3176	CLIP-seq
MIRT1937527	hsa-miR-371-5p	CLIP-seq
MIRT804315	hsa-miR-372	CLIP-seq
MIRT804316	hsa-miR-373	CLIP-seq
MIRT1937528	hsa-miR-3922-3p	CLIP-seq
MIRT804323	hsa-miR-4312	CLIP-seq
MIRT804361	hsa-miR-433	CLIP-seq
MIRT804327	hsa-miR-4428	CLIP-seq
MIRT804363	hsa-miR-4520b-3p	CLIP-seq
MIRT804364	hsa-miR-4529-3p	CLIP-seq
MIRT804329	hsa-miR-4533	CLIP-seq
MIRT804331	hsa-miR-4683	CLIP-seq
MIRT804333	hsa-miR-4722-3p	CLIP-seq
MIRT804334	hsa-miR-4731-5p	CLIP-seq
MIRT804335	hsa-miR-4747-5p	CLIP-seq
MIRT804336	hsa-miR-4757-5p	CLIP-seq
MIRT804338	hsa-miR-4779	CLIP-seq
MIRT804366	hsa-miR-4804-5p	CLIP-seq
MIRT804340	hsa-miR-512-3p	CLIP-seq
MIRT804342	hsa-miR-519d	CLIP-seq
MIRT804343	hsa-miR-520a-3p	CLIP-seq
MIRT804344	hsa-miR-520c-3p	CLIP-seq
MIRT804345	hsa-miR-520d-3p	CLIP-seq
MIRT804346	hsa-miR-520e	CLIP-seq
MIRT804347	hsa-miR-520g	CLIP-seq
MIRT804348	hsa-miR-520h	CLIP-seq
MIRT804354	hsa-miR-93	CLIP-seq
MIRT2177154	hsa-miR-1207-5p	CLIP-seq
MIRT2177155	hsa-miR-1827	CLIP-seq
MIRT2177156	hsa-miR-1909	CLIP-seq
MIRT804292	hsa-miR-192	CLIP-seq
MIRT804294	hsa-miR-1976	CLIP-seq
MIRT804299	hsa-miR-215	CLIP-seq
MIRT804306	hsa-miR-3130-3p	CLIP-seq
MIRT1937527	hsa-miR-371-5p	CLIP-seq
MIRT2177157	hsa-miR-3927	CLIP-seq
MIRT804319	hsa-miR-4252	CLIP-seq
MIRT804361	hsa-miR-433	CLIP-seq
MIRT2177158	hsa-miR-4421	CLIP-seq
MIRT804327	hsa-miR-4428	CLIP-seq
MIRT2177159	hsa-miR-4451	CLIP-seq
MIRT2177160	hsa-miR-4493	CLIP-seq
MIRT2177161	hsa-miR-4525	CLIP-seq
MIRT804331	hsa-miR-4683	CLIP-seq
MIRT2177162	hsa-miR-4716-3p	CLIP-seq
MIRT804333	hsa-miR-4722-3p	CLIP-seq
MIRT804336	hsa-miR-4757-5p	CLIP-seq
MIRT2177163	hsa-miR-4763-3p	CLIP-seq
MIRT2177164	hsa-miR-493	CLIP-seq
MIRT2177165	hsa-miR-524-3p	CLIP-seq
MIRT2177166	hsa-miR-525-3p	CLIP-seq
MIRT2177167	hsa-miR-940	CLIP-seq
MIRT804355	hsa-miR-941	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
DDIT3	Repression	16164412
EBF1	Unknown	20423929
NPM1	Repression	22528486

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	15890932
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	21873635
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16300731
GO:0003682	Function	Chromatin binding	IDA	21212266
GO:0003700	Function	DNA-binding transcription factor activity	IDA	20654631
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0005515	Function	Protein binding	IPI	10373550, 12812986, 20102225, 22528486, 26213385, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	22528486
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005813	Component	Centrosome	IDA	26213385
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	20654631
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007623	Process	Circadian rhythm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	22528486
GO:0009791	Process	Post-embryonic development	IEA
GO:0015631	Function	Tubulin binding	IDA	26213385
GO:0019900	Function	Kinase binding	IPI	25512613
GO:0021891	Process	Olfactory bulb interneuron development	IEA
GO:0021930	Process	Cerebellar granule cell precursor proliferation	ISS
GO:0035264	Process	Multicellular organism growth	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	21212266
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045444	Process	Fat cell differentiation	IMP	24216764
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	22528486
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	21212266, 25512613
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16300731
GO:0046605	Process	Regulation of centrosome cycle	IDA	26213385
GO:1902750	Process	Negative regulation of cell cycle G2/M phase transition	IDA	22528486

MIM	HGNC	e!Ensembl
606398	790	ENSG00000169136

Protein

UniProt ID

Q9Y2D1

Protein name

Cyclic AMP-dependent transcription factor ATF-5 (cAMP-dependent transcription factor ATF-5) (Activating transcription factor 5) (Transcription factor ATFx)

Protein function

Transcription factor that either stimulates or represses gene transcription through binding of different DNA regulatory elements such as cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), ATF5-specific response element (ARE) (consen

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	206 → 268	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with higher expression levels in liver. {ECO:0000269|PubMed:18332083}.

Sequence

MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAG
DGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAP
PLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPL
PPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGEC
QGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTRSC

Sequence length

282

Interactions

View interactions

ATF5 (activating transcription factor 5)