Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22806
Gene name Gene Name - the full gene name approved by the HGNC.
IKAROS family zinc finger 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IKZF3
Synonyms (NCBI Gene) Gene synonyms aliases
AIO, AIOLOS, IMD84, ZNFN1A3
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IMD84
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12-q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene prod
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT054201 hsa-miR-125b-5p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 22723551
MIRT681314 hsa-miR-890 HITS-CLIP 23706177
MIRT511400 hsa-miR-4695-5p HITS-CLIP 23706177
MIRT511399 hsa-miR-4779 HITS-CLIP 23706177
MIRT511398 hsa-miR-3929 HITS-CLIP 23706177
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
GO:0003700 Function DNA-binding transcription factor activity IBA 21873635
GO:0005515 Function Protein binding IPI 10369681, 11714801, 17646674, 20676092, 21516116, 24722188, 25416956, 25910212, 26871637, 27107012, 28514442, 29892012, 31515488, 32296183
GO:0005634 Component Nucleus IDA 10369681, 17646674
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606221 13178 ENSG00000161405
Protein
UniProt ID Q9UKT9
Protein name Zinc finger protein Aiolos (Ikaros family zinc finger protein 3)
Protein function Transcription factor that plays an important role in the regulation of lymphocyte differentiation. Plays an essential role in regulation of B-cell differentiation, proliferation and maturation to an effector state. Involved in regulating BCL2 ex
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 146 168 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 202 223 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed most strongly in peripheral blood leukocytes, the spleen, and the thymus. {ECO:0000269|PubMed:17646674}.
Sequence
MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKV
KDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNC
DVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCN
YACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAE
ARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQ
TRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELE
KKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKE
VPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPF
ECNMCGYRSHDRYEFSSHIARGEHRALLK
Sequence length 509
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Atopic rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 26542096
Esophagus neoplasm Esophageal Neoplasms rs28934578, rs121918714, rs1567556006, rs1575166666 22960999
Immunoglobulin a deficiency Immunoglobulin A deficiency (disorder) rs72553883, rs72553882, rs144718007 27723758
Lymphoblastic leukemia Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699
View all (13 more)
23334668
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma, Childhood asthma 24388013, 25256354, 24406073, 30787307, 28461288, 20860503, 21804549, 26542096, 17611496 ClinVar, GWAS
Immunodeficiency immunodeficiency 84 GenCC
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Biliary Cholangitis Biliary Cholangitis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 16849520
Adenocarcinoma Of Esophagus Associate 16849520
Agammaglobulinemia Associate 38015619
Arthritis Rheumatoid Stimulate 29193869
Arthritis Rheumatoid Inhibit 35883614
Asthma Associate 21985515, 23154084, 24406073, 28241063, 28668238, 32078577, 36967681, 38494094, 40105091
Atherosclerosis Associate 38193570
Autoimmune Diseases Associate 38015619
Breast Neoplasms Associate 21247443
Breast Neoplasms Male Associate 25906114