Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
22796
Gene name Gene Name - the full gene name approved by the HGNC.
Component of oligomeric golgi complex 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COG2
Synonyms (NCBI Gene) Gene synonyms aliases
CDG2Q, LDLC
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q42.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessar
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1031719032 ->A Pathogenic Frameshift variant, coding sequence variant
rs1085307116 ->A Pathogenic Stop gained, coding sequence variant
rs1085307117 T>G Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020037 hsa-miR-375 Microarray 20215506
MIRT021018 hsa-miR-155-5p Proteomics 18668040
MIRT045156 hsa-miR-186-5p CLASH 23622248
MIRT902092 hsa-miR-1254 CLIP-seq
MIRT902093 hsa-miR-2113 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane NAS 27066481
GO:0000139 Component Golgi membrane TAS
GO:0000301 Process Retrograde transport, vesicle recycling within Golgi IMP 27066481
GO:0005515 Function Protein binding IPI 15047703, 25416956, 31515488, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606974 6546 ENSG00000135775
Protein
UniProt ID Q14746
Protein name Conserved oligomeric Golgi complex subunit 2 (COG complex subunit 2) (Component of oligomeric Golgi complex 2) (Low density lipoprotein receptor defect C-complementing protein)
Protein function Required for normal Golgi morphology and function.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06148 COG2 15 147 COG (conserved oligomeric Golgi) complex component, COG2 Family
PF12022 DUF3510 573 699 Domain of unknown function (DUF3510) Family
Sequence
MEKSRMNLPKGPDTLCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAM
VELINKDYADFVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQ
EDIRKKKMCVLRLIQVIRSVEKIEKIL
NSQSSKETSALEASSPLLTGQILERIATEFNQL
QFHAVQSKGMPLLDKVRPRIAGITAMLQQSLEGLLLEGLQTSDVDIIRHCLRTYATIDKT
RDAEALVGQVLVKPYIDEVIIEQFVESHPNGLQVMYNKLLEFVPHHCRLLREVTGGAISS
EKGNTVPGYDFLVNSVWPQIVQGLEEKLPSLFNPGNPDAFHEKYTISMDFVRRLERQCGS
QASVKRLRAHPAYHSFNKKWNLPVYFQIRFREIAGSLEAALTDVLEDAPAESPYCLLASH
RTWSSLRRCWSDEMFLPLLVHRLWRLTLQILARYSVFVNELSLRPISNESPKEIKKPLVT
GSKEPSITQGNTEDQGSGPSETKPVVSISRTQLVYVVADLDKLQEQLPELLEIIKPKLEM
IGFKNFSSISAALEDSQSSFSACVPSLSSKIIQDLSDSCFGFLKSALEVPRLYRRTNKEV
PTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKM
EESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDV
EYLGEQIQKLGLQASDIKSFS
ALAELVAAAKDQATAEQP
Sequence length 738
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    COPI-mediated anterograde transport
Intra-Golgi traffic
Retrograde transport at the Trans-Golgi-Network
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Congenital Disorder Of Glycosylation congenital disorder of glycosylation, type iiq rs1085307116, rs1085307117, rs1031719032 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Stimulate 39923073
Cardiovascular Diseases Associate 37861809
Cerebral Small Vessel Diseases Stimulate 37950256
Coronary Artery Disease Stimulate 12754559, 17704557
Dementia Associate 37950256
Diabetes Mellitus Type 1 Associate 36589806
Fatty Liver Associate 34899591
Glomerulonephritis IGA Associate 36589806
Hyperlipoproteinemia Type II Associate 28104544, 30637778, 36707646, 39337524
Hypobetalipoproteinemias Inhibit 33207932