Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	22795
Gene name Gene Name - the full gene name approved by the HGNC.	Nidogen 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NID2
Synonyms (NCBI Gene) Gene synonyms aliases	NID-2
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the nidogen family of basement membrane proteins. This protein is a cell-adhesion protein that binds collagens I and IV and laminin and may be involved in maintaining the structure of the basement membrane.[provided by RefSeq

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022756	hsa-miR-124-3p	Microarray	18668037
MIRT052404	hsa-let-7a-5p	CLASH	23622248
MIRT041174	hsa-miR-181d-5p	CLASH	23622248
MIRT1184851	hsa-miR-33a	CLIP-seq
MIRT1184852	hsa-miR-33b	CLIP-seq
MIRT1184853	hsa-miR-4277	CLIP-seq
MIRT1184854	hsa-miR-544	CLIP-seq
MIRT2053603	hsa-miR-1182	CLIP-seq
MIRT2053604	hsa-miR-1208	CLIP-seq
MIRT2053605	hsa-miR-1264	CLIP-seq
MIRT2053606	hsa-miR-2116	CLIP-seq
MIRT2053607	hsa-miR-2909	CLIP-seq
MIRT2053608	hsa-miR-4677-5p	CLIP-seq
MIRT2431604	hsa-miR-2467-3p	CLIP-seq
MIRT2431605	hsa-miR-3678-3p	CLIP-seq
MIRT2431606	hsa-miR-4257	CLIP-seq
MIRT2431607	hsa-miR-548c-3p	CLIP-seq
MIRT2455177	hsa-miR-1252	CLIP-seq
MIRT2455178	hsa-miR-218	CLIP-seq
MIRT2455179	hsa-miR-3159	CLIP-seq
MIRT2455180	hsa-miR-3187-3p	CLIP-seq
MIRT2455181	hsa-miR-4435	CLIP-seq
MIRT2455182	hsa-miR-4470	CLIP-seq
MIRT2455183	hsa-miR-4701-5p	CLIP-seq
MIRT2455184	hsa-miR-4717-3p	CLIP-seq
MIRT2455185	hsa-miR-4761-5p	CLIP-seq
MIRT2455186	hsa-miR-4775	CLIP-seq
MIRT2455187	hsa-miR-548s	CLIP-seq
MIRT2455188	hsa-miR-578	CLIP-seq
MIRT2455189	hsa-miR-588	CLIP-seq
MIRT2455190	hsa-miR-636	CLIP-seq
MIRT2455191	hsa-miR-651	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	ISS
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 27068509, 27559042, 28327460, 28675934
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	11956183
GO:0005518	Function	Collagen binding	TAS	9733643
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IBA	21873635
GO:0005604	Component	Basement membrane	IDA	22952693
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0007155	Process	Cell adhesion	TAS	9733643
GO:0007160	Process	Cell-matrix adhesion	IBA	21873635
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	23658023, 27068509, 27559042, 28327460, 28675934
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	20551380
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071711	Process	Basement membrane organization	TAS	22952693

MIM	HGNC	e!Ensembl
605399	13389	ENSG00000087303

Protein

UniProt ID

Q14112

Protein name

Nidogen-2 (NID-2) (Osteonidogen)

Protein function

Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06119	NIDO	179 → 272	Nidogen-like	Family
PF07474	G2F	527 → 713	G2F domain	Domain
PF12947	EGF_3	896 → 929	EGF domain	Domain
PF00086	Thyroglobulin_1	940 → 1005	Thyroglobulin type-1 repeat	Domain
PF00086	Thyroglobulin_1	1019 → 1084	Thyroglobulin type-1 repeat	Domain
PF00058	Ldl_recept_b	1198 → 1238	Low-density lipoprotein receptor repeat class B	Repeat
PF00058	Ldl_recept_b	1241 → 1283	Low-density lipoprotein receptor repeat class B	Repeat

Tissue specificity

TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Heart and bone. Less in pancreas, kidney and skeletal muscle. {ECO:0000269|PubMed:32337544}.

Sequence

MEGDRVAGRPVLSSLPVLLLLPLLMLRAAALHPDELFPHGESWGDQLLQEGDDESSAVVK
LANPLHFYEARFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRG
RVLYREDTSPAVLGLAARYVRAGFPRSARFTPTHAFLATWEQVGAYEEVKRGALPSGELN
TFQAVLASDGSDSYALFLYPANGLQFLGTRPKESYNVQLQLPARVGFCRGEADDLKSEGP
YFSLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSF
SHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKPLEESST
LDPHTKEGTSLGEVGGPDLKGQVEPWDERETRSPAPPEVDRDSLAPSWETPPPYPENGSI
QPYPDGGPVPSEMDVPPAHPEEEIVLRSYPASGHTTPLSRGTYEVGLEDNIGSNTEVFTY
NAANKETCEHNHRQCSRHAFCTDYATGFCCHCQSKFYGNGKHCLPEGAPHRVNGKVSGHL
HVGHTPVHFTDVDLHAYIVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPG
SENGFSLAGAAFTHDMEVTFYPGEETVRITQTAEGLDPENYLSIKTNIQGQVPYVSANFT
AHISPYKELYHYSDSTVTSTSSRDYSLTFGAINQTWSYRIHQNITYQVCRHAPRHPSFPT
TQQLNVDRVFALYNDEERVLRFAVTNQIGPVKEDSDPTPGNPCYDGSHMCDTTARCHPGT
GVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRH
TCILITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTDVDECSENR
CHPAATCYNTPGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEQQQRHAQAQYAYPGARFHI
PQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPSPEPTQRPPTICE
RWRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGT
TPACIPTVAPPMVRPTPRPDVTPPSVGTFLLYTQGQQIGYLPLNGTRLQKDAAKTLLSLH
GSIIVGIDYDCRERMVYWTDVAGRTISRAGLELGAEPETIVNSGLISPEGLAIDHIRRTM
YWTDSVLDKIESALLDGSERKVLFYTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSSL
DGENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFS
IVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK

Sequence length

1375

Interactions

View interactions

	KEGG		Reactome
	Cytoskeleton in muscle cells		Laminin interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma Follicular	Associate	21420716
Alzheimer Disease	Associate	35627223
Amyotrophic Lateral Sclerosis	Associate	36768220
Breast Neoplasms	Associate	33500458
Carcinoma Non Small Cell Lung	Associate	29970687
Carcinoma Renal Cell	Associate	24980822
Cholesteatoma	Associate	25093596
Colonic Diseases	Associate	17328794
Colorectal Neoplasms	Associate	35247911
Endometrial Neoplasms	Associate	27874289
Endometriosis	Associate	36232817
Gastrointestinal Neoplasms	Associate	17328794
Glioma	Associate	40332526
Idiopathic Pulmonary Fibrosis	Associate	31426504
Landau Kleffner Syndrome	Associate	24828792
Leukemia Myeloid Acute	Associate	24493670
Lichen Planus Oral	Associate	32171289
Lung Neoplasms	Associate	31526458
Myositis Inclusion Body	Associate	21672074
Neoplasms	Associate	17328794, 40332526
Neoplasms Germ Cell and Embryonal	Associate	30929729
Osteoarthritis	Associate	18438862
Osteoarthritis Knee	Associate	18438862
Osteoporosis	Associate	32999266
Pemphigoid Bullous	Associate	17637825
Scleroderma Diffuse	Associate	29760157
Squamous Cell Carcinoma of Head and Neck	Associate	21558411, 32171289
Stomach Neoplasms	Associate	17328794, 33758160
Urethral Neoplasms	Associate	28106542
Urinary Bladder Neoplasms	Associate	28106542, 29854012

NID2 (nidogen 2)