VEGFD (vascular endothelial growth factor D)

Gene
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2277
Gene name Gene Name - the full gene name approved by the HGNC.
Vascular endothelial growth factor D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VEGFD
Synonyms (NCBI Gene) Gene synonyms aliases
FIGF, VEGF-D
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp22.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a compl
Transcription factors
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
Transcription factor Regulation Reference
FOS Unknown 19136250
JUN Unknown 19136250
NFKB1 Activation 18941249
RELA Activation 18941249
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(32)
GO ID Ontology Definition Evidence Reference
GO:0001666 Process Response to hypoxia IBA 21873635
GO:0001934 Process Positive regulation of protein phosphorylation IBA 21873635
GO:0001938 Process Positive regulation of endothelial cell proliferation IBA 21873635
GO:0002040 Process Sprouting angiogenesis IBA 21873635
GO:0002576 Process Platelet degranulation TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
300091 3708 ENSG00000165197
Protein
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O43915
Protein name Vascular endothelial growth factor D (VEGF-D) (c-Fos-induced growth factor) (FIGF)
Protein function Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphat
PDB 2XV7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00341 PDGF 111 → 191 PDGF/VEGF domain Domain
PF03128 CXCXC 262 → 273 CXCXC repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung, heart, small intestine and fetal lung, and at lower levels in skeletal muscle, colon, and pancreas.
Sequence 
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP
Sequence length 354
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
TNF signaling pathway
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer 		  Platelet degranulation
VEGF ligand-receptor interactions
VEGF binds to VEGFR leading to receptor dimerization
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lymphangiomyomatosis Lymphangioleiomyomatosis rs118203388, rs45483392, rs45517179, rs28934872, rs45517148, rs118203537, rs118203707, rs137854360, rs45517169, rs45517299, rs137854210, rs45517213, rs45517132, rs45514095, rs137854157
View all (8 more)		 20038814
Show/Hide Text Mining Associations (94)
Associations from Text Mining
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Stimulate 15220918
Adenocarcinoma of Lung Inhibit 17970036
Adenocarcinoma of Lung Associate 34612148
Adenolymphoma Associate 29097817
Angina Pectoris Inhibit 34593990
Bone Marrow Diseases Stimulate 32383346
Breast Neoplasms Associate 10551327, 12115372, 15280403, 16080559, 16617567, 17353919, 17695512, 22581182, 22694825, 22906075, 28791841, 35472078
Calcinosis Cutis Associate 17695512, 23577117
Carcinoma Adenoid Cystic Associate 21423152
Carcinoma Ductal Associate 16080559