Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2277
Gene name Gene Name - the full gene name approved by the HGNC.
Vascular endothelial growth factor D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VEGFD
Synonyms (NCBI Gene) Gene synonyms aliases
FIGF, VEGF-D
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp22.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a compl
Transcription factors
Transcription factor Regulation Reference
FOS Unknown 19136250
JUN Unknown 19136250
NFKB1 Activation 18941249
RELA Activation 18941249
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001666 Process Response to hypoxia IBA
GO:0002040 Process Sprouting angiogenesis IBA
GO:0005161 Function Platelet-derived growth factor receptor binding TAS 9479493
GO:0005172 Function Vascular endothelial growth factor receptor binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300091 3708 ENSG00000165197
Protein
UniProt ID O43915
Protein name Vascular endothelial growth factor D (VEGF-D) (c-Fos-induced growth factor) (FIGF)
Protein function Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphat
PDB 2XV7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00341 PDGF 111 191 PDGF/VEGF domain Domain
PF03128 CXCXC 262 273 CXCXC repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung, heart, small intestine and fetal lung, and at lower levels in skeletal muscle, colon, and pancreas.
Sequence
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
VKVANHTGCKC
LPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP
Sequence length 354
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
TNF signaling pathway
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
  Platelet degranulation
VEGF ligand-receptor interactions
VEGF binds to VEGFR leading to receptor dimerization
<