Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2275
Gene name Gene Name - the full gene name approved by the HGNC.	Four and a half LIM domains 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FHL3
Synonyms (NCBI Gene) Gene synonyms aliases	SLIM2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The encoded protein has been shown to interact with the cancer developmental regulators SMA

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050493	hsa-miR-20a-5p	CLASH	23622248
MIRT044705	hsa-miR-320a	CLASH	23622248
MIRT736028	hsa-miR-663a	Luciferase reporter assay, Western blotting, qRT-PCR	33000682
MIRT2533420	hsa-miR-1233	CLIP-seq
MIRT2533421	hsa-miR-1276	CLIP-seq
MIRT2533422	hsa-miR-142-5p	CLIP-seq
MIRT2533423	hsa-miR-2110	CLIP-seq
MIRT2533424	hsa-miR-3150a-3p	CLIP-seq
MIRT2533425	hsa-miR-3175	CLIP-seq
MIRT2533426	hsa-miR-340	CLIP-seq
MIRT2533427	hsa-miR-3936	CLIP-seq
MIRT2533428	hsa-miR-4260	CLIP-seq
MIRT2533429	hsa-miR-4311	CLIP-seq
MIRT2533430	hsa-miR-4443	CLIP-seq
MIRT2533431	hsa-miR-4464	CLIP-seq
MIRT2533432	hsa-miR-4477b	CLIP-seq
MIRT2533433	hsa-miR-4721	CLIP-seq
MIRT2533434	hsa-miR-4748	CLIP-seq
MIRT2533435	hsa-miR-4777-5p	CLIP-seq
MIRT2533436	hsa-miR-518d-5p	CLIP-seq
MIRT2533437	hsa-miR-519b-5p	CLIP-seq
MIRT2533438	hsa-miR-519c-5p	CLIP-seq
MIRT2533439	hsa-miR-520c-5p	CLIP-seq
MIRT2533440	hsa-miR-526a	CLIP-seq
MIRT2533441	hsa-miR-583	CLIP-seq
MIRT2533442	hsa-miR-601	CLIP-seq
MIRT2533443	hsa-miR-939	CLIP-seq
MIRT2533421	hsa-miR-1276	CLIP-seq
MIRT2533422	hsa-miR-142-5p	CLIP-seq
MIRT2533426	hsa-miR-340	CLIP-seq
MIRT2533427	hsa-miR-3936	CLIP-seq
MIRT2533429	hsa-miR-4311	CLIP-seq
MIRT2533430	hsa-miR-4443	CLIP-seq
MIRT2533431	hsa-miR-4464	CLIP-seq
MIRT2533432	hsa-miR-4477b	CLIP-seq
MIRT2533433	hsa-miR-4721	CLIP-seq
MIRT2533434	hsa-miR-4748	CLIP-seq
MIRT2533435	hsa-miR-4777-5p	CLIP-seq
MIRT2533441	hsa-miR-583	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IBA
GO:0001725	Component	Stress fiber	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003779	Function	Actin binding	IBA
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 25416956, 25910212, 26871637, 27107012, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007517	Process	Muscle organ development	TAS	10049693
GO:0008270	Function	Zinc ion binding	IEA
GO:0030018	Component	Z disc	IBA
GO:0030018	Component	Z disc	IEA
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
602790	3704	ENSG00000183386

Protein

UniProt ID

Q13643

Protein name

Four and a half LIM domains protein 3 (FHL-3) (Skeletal muscle LIM-protein 2) (SLIM-2)

Protein function

Recruited by SOX15 to FOXK1 promoters where it acts as a transcriptional coactivator of FOXK1.

PDB

1WYH , 2CUQ , 2EHE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	40 → 97	LIM domain	Domain
PF00412	LIM	101 → 158	LIM domain	Domain
PF00412	LIM	162 → 217	LIM domain	Domain
PF00412	LIM	221 → 279	LIM domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed only in skeletal muscle.

Sequence

MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRH
FHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQ
TWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQP
WHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFE
DRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

Sequence length

280

Interactions

View interactions

	KEGG
	Cytoskeleton in muscle cells

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Inhibit	22362714
Carcinoma Hepatocellular	Associate	22362714
Carcinoma Pancreatic Ductal	Associate	31935687
Cardiomyopathies	Associate	25137373
Cardiomyopathy Dilated	Associate	25137373
Fever	Associate	16825436
Hematologic Diseases	Associate	16825436
Lymphohistiocytosis Hemophagocytic	Associate	14622600, 15466010, 15632205, 16778144, 19884660, 21152410, 21653941, 22796692, 22970278, 26342526, 29410181, 29549174, 32375849, 33746956
Neoplasm Metastasis	Associate	31935687
Neoplasms	Associate	16778144, 23086815
Pancreatic Neoplasms	Associate	31935687
Splenomegaly	Associate	16825436

FHL3 (four and a half LIM domains 3)