FHIT (fragile histidine triad diadenosine triphosphatase)

Gene

• Entrez ID: 2272
• Gene name: Fragile histidine triad diadenosine triphosphatase
• Gene symbol: FHIT
• Synonyms (NCBI Gene): AP3Aase, FRA3B
• Chromosome: 3
• Chromosome location: 3p14.2
• Summary: The protein encoded by this gene is a P1-P3-bis(5`-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006362	hsa-miR-143-3p	Luciferase reporter assay	21711110
MIRT006362	hsa-miR-143-3p	Luciferase reporter assay	21711110
MIRT006363	hsa-miR-217	Luciferase reporter assay	21711110
MIRT006364	hsa-miR-331-3p	Luciferase reporter assay	21711110
MIRT006365	hsa-miR-625-5p	Luciferase reporter assay	21711110
MIRT006362	hsa-miR-143-3p	Luciferase reporter assay	21711110
MIRT006362	hsa-miR-143-3p	Luciferase reporter assay	21711110
MIRT006365	hsa-miR-625-5p	Luciferase reporter assay	21711110
MIRT006362	hsa-miR-143-3p	Luciferase reporter assay	21711110
MIRT006362	hsa-miR-143-3p	Luciferase reporter assay	21711110
MIRT006365	hsa-miR-625-5p	Luciferase reporter assay	21711110
MIRT996523	hsa-miR-103a	CLIP-seq
MIRT996524	hsa-miR-107	CLIP-seq
MIRT996525	hsa-miR-1252	CLIP-seq
MIRT996526	hsa-miR-1301	CLIP-seq
MIRT996527	hsa-miR-3919	CLIP-seq
MIRT996528	hsa-miR-5047	CLIP-seq
MIRT996529	hsa-miR-922	CLIP-seq
MIRT996530	hsa-miR-1287	CLIP-seq
MIRT996531	hsa-miR-3135b	CLIP-seq
MIRT996532	hsa-miR-4766-5p	CLIP-seq
MIRT1995487	hsa-miR-1273f	CLIP-seq
MIRT1995488	hsa-miR-143	CLIP-seq
MIRT1995489	hsa-miR-3185	CLIP-seq
MIRT1995490	hsa-miR-4708-5p	CLIP-seq
MIRT1995491	hsa-miR-4710	CLIP-seq
MIRT1995492	hsa-miR-4738-3p	CLIP-seq
MIRT1995493	hsa-miR-4770	CLIP-seq
MIRT1995494	hsa-miR-4792	CLIP-seq
MIRT1995487	hsa-miR-1273f	CLIP-seq
MIRT1995488	hsa-miR-143	CLIP-seq
MIRT1995489	hsa-miR-3185	CLIP-seq
MIRT1995490	hsa-miR-4708-5p	CLIP-seq
MIRT1995491	hsa-miR-4710	CLIP-seq
MIRT1995492	hsa-miR-4738-3p	CLIP-seq
MIRT1995493	hsa-miR-4770	CLIP-seq
MIRT1995494	hsa-miR-4792	CLIP-seq
MIRT1995487	hsa-miR-1273f	CLIP-seq
MIRT1995488	hsa-miR-143	CLIP-seq
MIRT1995489	hsa-miR-3185	CLIP-seq
MIRT1995490	hsa-miR-4708-5p	CLIP-seq
MIRT1995491	hsa-miR-4710	CLIP-seq
MIRT1995492	hsa-miR-4738-3p	CLIP-seq
MIRT1995493	hsa-miR-4770	CLIP-seq
MIRT1995494	hsa-miR-4792	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Repression	15044096

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0003824	Function	Catalytic activity	IEA
GO:0005515	Function	Protein binding	IPI	18077326, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15007172
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA	15313915
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0006163	Process	Purine nucleotide metabolic process	IBA
GO:0006163	Process	Purine nucleotide metabolic process	IDA	9323207
GO:0006915	Process	Apoptotic process	IEA
GO:0015964	Process	Diadenosine triphosphate catabolic process	IBA
GO:0015964	Process	Diadenosine triphosphate catabolic process	IDA	8794732
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	15313915
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	15313915
GO:0042802	Function	Identical protein binding	IPI	9261067, 9576908, 16189514, 18077326, 24722188, 25416956, 27107012, 31515488, 32296183
GO:0043530	Function	Adenosine 5'-monophosphoramidase activity	IDA	18694747
GO:0043530	Function	Adenosine 5'-monophosphoramidase activity	IEA
GO:0047352	Function	Adenylylsulfate-ammonia adenylyltransferase activity	IDA	26181368
GO:0047352	Function	Adenylylsulfate-ammonia adenylyltransferase activity	IEA
GO:0047627	Function	Adenylylsulfatase activity	IDA	18694747
GO:0047627	Function	Adenylylsulfatase activity	IEA
GO:0047710	Function	Bis(5'-adenosyl)-triphosphatase activity	IBA
GO:0047710	Function	Bis(5'-adenosyl)-triphosphatase activity	IDA	8794732, 9323207, 9543008
GO:0047710	Function	Bis(5'-adenosyl)-triphosphatase activity	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IBA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IMP	15313915

Other IDs

• MIM: 601153
• HGNC: 3701
• e!Ensembl: ENSG00000189283

Protein

• UniProt ID: P49789
• Protein name: Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.29) (AP3A hydrolase) (AP3Aase) (Adenosine 5'-monophosphoramidase FHIT) (EC 3.9.1.-) (Adenylylsulfatase) (EC 3.6.2.1) (Adenylylsulfate-ammonia adenylyltransferase) (EC 2.7.7.51) (Diadenosine 5',5'''-P1,P3-triphosph
• Protein function: Possesses dinucleoside triphosphate hydrolase activity (PubMed:12574506, PubMed:15182206, PubMed:8794732, PubMed:9323207, PubMed:9543008, PubMed:9576908). Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP (PubMed:125745
• PDB: 1FHI, 1FIT, 2FHI, 2FIT, 3FIT, 4FIT, 5FIT, 6FIT, 7P8P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01230	HIT	9 → 105	HIT domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Low levels expressed in all tissues tested. Phospho-FHIT observed in liver and kidney, but not in brain and lung. Phospho-FHIT undetected in all tested human tumor cell lines.
• Sequence:

  MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
  TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
  DKEDFPASWRSEEEMAAEAAALRVYFQ

• Sequence length: 147

Pathways

KEGG:

Purine metabolism
Metabolic pathways
Small cell lung cancer
Non-small cell lung cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPERGER SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIOVENTRICULAR BLOCK	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FHIT-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and oral cavity carcinoma	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-OPERATIVE MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE ACUTE RESPIRATORY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Abnormalities Drug Induced	Associate	18592004	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	11170287, 11461085, 12765416, 15150628, 16237777, 17348444, 18663352, 31001805	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Inhibit	12865924	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	25401976, 38069335	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Stimulate	35254116	★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	12890744, 25091577	★☆☆☆☆ Found in Text Mining only
Adenoma	Inhibit	14760383	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Associate	23019410, 30737237	★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Associate	28289900	★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Associate	17393360	★☆☆☆☆ Found in Text Mining only
Anxiety	Associate	22628180, 29249830	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	37466093	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Associate	23375656, 24204716	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Associate	20647332, 31001805	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma In Situ	Associate	17164758	★☆☆☆☆ Found in Text Mining only
Breast Diseases	Associate	17164758	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	10666370, 15047740, 15073846, 20417865, 25735361, 30941950	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	19130459	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Associate	19759907	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	10027335, 10411902, 10555761, 10732756, 11746990, 12669232, 12698186, 12800227, 14675322, 15256063, 15627891, 15929169, 16187332, 16237777, 18517280, 18592004, 19414370, 19760177, 20606729, 22393963, 22496620, 25040980, 28289900, 38069335, 8620533, 9261067, 9401074, 9403704	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Inhibit	14760383, 16821595	★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	18517280	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Associate	10389981, 15060557, 15633221, 18567082, 19818350, 21679157, 30773529, 9472637	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Inhibit	12800227	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Associate	17164758	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Inhibit	17164758	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Associate	17348444	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Inhibit	10735505, 14976524	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	12765416, 12865924, 15042681, 15150628, 16533421, 17328863, 20521346, 20736951, 25040980, 8620533	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	28289900	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	10666370, 18517280, 25230976, 3125959, 8598045	★☆☆☆☆ Found in Text Mining only
Carcinoma Signet Ring Cell	Inhibit	12218081	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Associate	17348444	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	10027335, 10732756, 15150628, 16821595, 19047905, 19131950	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Inhibit	12765416, 12865924, 35254116	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Inhibit	10666370	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Associate	22393963	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Associate	19414370	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	24757411	★☆☆☆☆ Found in Text Mining only
Chordoma	Inhibit	23019410	★☆☆☆☆ Found in Text Mining only
Chromosome Fragility	Associate	12057912	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Inhibit	17143956	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	17393360, 8598045	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	10555761, 12177781, 17373735, 23573237, 39332629, 9197530	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	23797051	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Inhibit	17143956	★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Associate	8598045	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Associate	10732756	★☆☆☆☆ Found in Text Mining only
Dyspepsia	Inhibit	15609389	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus Syndrome	Associate	12057912	★☆☆☆☆ Found in Text Mining only
Encephalitis Herpes Simplex	Associate	10027335	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Associate	15627891	★☆☆☆☆ Found in Text Mining only
Epstein Barr Virus Infections	Associate	15929169	★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Associate	19414370, 20163722	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Inhibit	16821595	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	39725880	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	22578181, 26857264	★☆☆☆☆ Found in Text Mining only
Focal Nodular Hyperplasia	Associate	10389981	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Associate	12057912	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Associate	12973852	★☆☆☆☆ Found in Text Mining only
Genetic Diseases Inborn	Associate	20647332	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	19760177	★☆☆☆☆ Found in Text Mining only
Granulosa Cell Tumor	Associate	15574200	★☆☆☆☆ Found in Text Mining only
Granulosa cell tumor of the ovary	Associate	15574200	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	11683369, 8790406	★☆☆☆☆ Found in Text Mining only
Helicobacter Infections	Inhibit	15609389	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	15073846, 17164758	★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	19832807	★☆☆☆☆ Found in Text Mining only
HTLV I Infections	Associate	34092254	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	12169206	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	17143956	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inhibit	17143956	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Associate	29531279	★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Associate	29531279	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	15357873, 27725787	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Inhibit	9403704	★☆☆☆☆ Found in Text Mining only
Kininogen Deficiency High Molecular Weight and Low Molecular Weight	Associate	10735505	★☆☆☆☆ Found in Text Mining only
Krukenberg Tumor	Inhibit	12218081	★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Associate	29531279	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	34092254	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	9401074	★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Associate	34092254	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	11683369, 19931269	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	10411902, 10735505, 11683369, 12169206, 12765416, 14976524, 15627891, 16513840, 16885564, 17328863, 17348444, 17694439, 17890317, 18319262, 18484646, 19181417, 20814237, 22425911, 23614702, 23709347, 24757411, 25040980, 25340791, 29540221, 30770797, 33437205, 34257703, 35254116, 8620533	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Inhibit	24464917	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Associate	17373735, 23573237	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Inhibit	20606729, 30941950	★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	16715073, 19832807, 20230398	★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	19832807, 20651033	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Effusion	Associate	21685375	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Cutaneous	Associate	35787399	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	10732756	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	19138989	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	21286011	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	11932901, 20473931, 22815911	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Inhibit	23534718	★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	10027335, 12057912	★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Inhibit	17164758	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	15633221, 25340791	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	23573237, 27245195	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	10377436, 10732756, 10735505, 11170287, 11683369, 11746990, 12574506, 12771912, 12890744, 15042681, 15389252, 15570308, 15574200, 16237777, 16343185, 17142325, 17143956, 17164758, 17552003, 17876837, 18413833, 19130459, 19399343, 19419937, 19434452, 19700237, 19760177, 20647332, 22425911, 22613411, 22675076, 23534718, 23573237, 23947369, 24477574, 24757411, 24782031, 25040980, 26857264, 27725787, 27835588, 28423547, 29752880, 33810183, 35176183, 8620533, 9197530, 9261067, 9405656, 9406824, 9543008, 9569038, 9667647	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	10389981, 10411902, 10666370, 11085938, 12057912, 12177781, 12627509, 12657123, 12669232, 12765416, 12800227, 12865924, 14675322, 14760383, 14976524, 15073846, 15150628, 15256063, 15627891, 15633221, 16187332, 16454554, 16885564, 17017123, 17142325, 17328863, 17393360, 17694439, 17890317, 18319262, 18953408, 19448592, 19818350, 20073072, 20671427, 20736951, 21069451, 21679157, 21685375, 21999220, 22085272, 22393963, 23704090, 24252461, 24464917, 25340791, 25401976, 25633809, 25735361, 26188848, 26497576, 28093273, 29282095, 29540221, 30737237, 30770797, 31266828, 33437205, 34092254, 35254116, 35787399, 38069335, 9573184, 9744498	★☆☆☆☆ Found in Text Mining only
Neoplasms Adipose Tissue	Associate	28767316	★☆☆☆☆ Found in Text Mining only
Neoplasms Glandular and Epithelial	Associate	12765416	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	23991058, 9667647	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuromuscular Diseases	Associate	29095316	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	28767316, 33491310	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Associate	9818023	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	9569038	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	11461085, 9569038	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	17912030	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Inhibit	19434452	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Associate	29249830	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Associate	34092254	★☆☆☆☆ Found in Text Mining only
Polyposis Syndrome Hereditary Mixed 1	Associate	17373735	★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	19700237	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20435627, 26745060	★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	9401074	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	18953408, 20053773	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatitis	Associate	12627509	★☆☆☆☆ Found in Text Mining only
Respiratory Insufficiency	Associate	29095316	★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Associate	19931269, 31001805	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Associate	9818023	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Associate	9406824	★☆☆☆☆ Found in Text Mining only
Skull Base Neoplasms	Inhibit	23019410	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	22085272, 3125959, 8620533	★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Associate	10666370	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	10732756, 11683369, 16454554, 19138989, 24278325, 25735654, 8790406, 9797729	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Inhibit	12218081, 12669232, 15609389	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Associate	14760383, 15929169, 16237777, 16773697, 17552003, 19419937, 22969225, 23131390, 25875960, 26857264	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tertiary Lymphoid Structures	Associate	15570308	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Associate	14670177	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Associate	12771912	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	19589279, 20606729, 28703219	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Inhibit	21069451	★☆☆☆☆ Found in Text Mining only
Tuberculosis Pulmonary	Associate	15627891	★☆☆☆☆ Found in Text Mining only
Urethral Neoplasms	Associate	22613411	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	10666370, 22393963, 22613411, 29752880	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	11875703, 14675322, 15570308, 31771040	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Inhibit	28414756	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	10027335, 12657123, 12698186, 14675322, 15570308, 16004614, 17009983, 19700237, 25422218, 31771040	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Inhibit	28414756	★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Associate	28414756	★☆☆☆☆ Found in Text Mining only
Vulvar Neoplasms	Associate	27835588	★☆☆☆☆ Found in Text Mining only