FGL1 (fibrinogen like 1)

Gene

• Entrez ID: 2267
• Gene name: Fibrinogen like 1
• Gene symbol: FGL1
• Synonyms (NCBI Gene): HFREP1, HP-041, HPS, LFIRE-1, LFIRE1
• Chromosome: 8
• Chromosome location: 8p22
• Summary: Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, thi

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Unknown	19304666

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	30580966
GO:0005576	Component	Extracellular region	IDA	30580966
GO:0005576	Component	Extracellular region	IEA
GO:0005577	Component	Fibrinogen complex	TAS	8390249
GO:0005615	Component	Extracellular space	IBA
GO:0007596	Process	Blood coagulation	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0050776	Process	Regulation of immune response	IBA
GO:0050776	Process	Regulation of immune response	ISS
GO:0050868	Process	Negative regulation of T cell activation	IBA
GO:0050868	Process	Negative regulation of T cell activation	ISS
GO:0072574	Process	Hepatocyte proliferation	IDA	19880967

Other IDs

• MIM: 605776
• HGNC: 3695
• e!Ensembl: ENSG00000104760

Protein

• UniProt ID: Q08830
• Protein name: Fibrinogen-like protein 1 (HP-041) (Hepassocin) (HPS) (Hepatocyte-derived fibrinogen-related protein 1) (HFREP-1) (Liver fibrinogen-related protein 1) (LFIRE-1)
• Protein function: Immune suppressive molecule that inhibits antigen-specific T-cell activation by acting as a major ligand of LAG3 (PubMed:30580966). Responsible for LAG3 T-cell inhibitory function (PubMed:30580966). Binds LAG3 independently from MHC class II (MH
• PDB: 7TZ2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00147	Fibrinogen_C	79 → 305	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Under normal conditions, liver-specific. {ECO:0000269|PubMed:11470158}.
• Sequence:

  MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEV
  QFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGW
  TVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFE
  KNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRD
  HDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVM
  KIRPNDFIPNVI

• Sequence length: 312

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	36268014	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	33123164	★☆☆☆☆ Found in Text Mining only
Basal Laminar Drusen	Associate	27007659	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	16980951, 32762721, 34069373, 35776395	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	33801246	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	37872170	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	34629811	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	18039467	★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	29845203	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	29845203, 35776395	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	33801246, 37872170	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	35776395	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	33801246	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	29845203	★☆☆☆☆ Found in Text Mining only
Takotsubo Cardiomyopathy	Associate	39513871	★☆☆☆☆ Found in Text Mining only