Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2264
Gene name Gene Name - the full gene name approved by the HGNC.	Fibroblast growth factor receptor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FGFR4
Synonyms (NCBI Gene) Gene synonyms aliases	CD334, JTK2, TKF
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a tyrosine kinase and cell surface receptor for fibroblast growth factors. The encoded protein is involved in the regulation of several pathways, including cell proliferation, cell differentiation, cell migration, lipid

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs351855	G>A	Pathogenic	Coding sequence variant, intron variant, missense variant
rs1057519792	C>A,G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519793	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1057520036	A>G	Likely-pathogenic	Missense variant, coding sequence variant, intron variant

Show/Hide all(125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT460224	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT460223	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT460222	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT460221	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT460220	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT460219	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT460217	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT460218	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT460216	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT460215	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT460214	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT460212	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT460213	hsa-miR-761	PAR-CLIP	23592263
MIRT460211	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT460210	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT460209	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT460208	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT460207	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT460206	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT460205	hsa-miR-5698	PAR-CLIP	23592263
MIRT460204	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT460203	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT460202	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT460201	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT460199	hsa-miR-4447	PAR-CLIP	23592263
MIRT460200	hsa-miR-4472	PAR-CLIP	23592263
MIRT460198	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT460197	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT736364	hsa-miR-486-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32313144
MIRT460224	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT460223	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT460222	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT460221	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT460220	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT460219	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT460217	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT460218	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT460216	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT460215	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT460214	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT460212	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT460213	hsa-miR-761	PAR-CLIP	23592263
MIRT460211	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT460210	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT460209	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT460208	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT460207	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT460206	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT460205	hsa-miR-5698	PAR-CLIP	23592263
MIRT460204	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT460203	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT460202	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT460201	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT460199	hsa-miR-4447	PAR-CLIP	23592263
MIRT460200	hsa-miR-4472	PAR-CLIP	23592263
MIRT460198	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT460197	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT996188	hsa-miR-138	CLIP-seq
MIRT996189	hsa-miR-15a	CLIP-seq
MIRT996190	hsa-miR-15b	CLIP-seq
MIRT996191	hsa-miR-16	CLIP-seq
MIRT996192	hsa-miR-1827	CLIP-seq
MIRT996193	hsa-miR-1909	CLIP-seq
MIRT996194	hsa-miR-195	CLIP-seq
MIRT996195	hsa-miR-1976	CLIP-seq
MIRT996196	hsa-miR-2110	CLIP-seq
MIRT996197	hsa-miR-214	CLIP-seq
MIRT996198	hsa-miR-3151	CLIP-seq
MIRT996199	hsa-miR-3153	CLIP-seq
MIRT996200	hsa-miR-3177-3p	CLIP-seq
MIRT996201	hsa-miR-3612	CLIP-seq
MIRT996202	hsa-miR-3689a-3p	CLIP-seq
MIRT996203	hsa-miR-3689c	CLIP-seq
MIRT996204	hsa-miR-3689d	CLIP-seq
MIRT996205	hsa-miR-370	CLIP-seq
MIRT996206	hsa-miR-424	CLIP-seq
MIRT996207	hsa-miR-4271	CLIP-seq
MIRT996208	hsa-miR-4660	CLIP-seq
MIRT996209	hsa-miR-4725-3p	CLIP-seq
MIRT996210	hsa-miR-4728-5p	CLIP-seq
MIRT996211	hsa-miR-4731-5p	CLIP-seq
MIRT996212	hsa-miR-4774-5p	CLIP-seq
MIRT996213	hsa-miR-497	CLIP-seq
MIRT996214	hsa-miR-564	CLIP-seq
MIRT996215	hsa-miR-650	CLIP-seq
MIRT996216	hsa-miR-940	CLIP-seq
MIRT996217	hsa-miR-1247	CLIP-seq
MIRT996218	hsa-miR-1266	CLIP-seq
MIRT996189	hsa-miR-15a	CLIP-seq
MIRT996190	hsa-miR-15b	CLIP-seq
MIRT996191	hsa-miR-16	CLIP-seq
MIRT996193	hsa-miR-1909	CLIP-seq
MIRT996194	hsa-miR-195	CLIP-seq
MIRT996196	hsa-miR-2110	CLIP-seq
MIRT996197	hsa-miR-214	CLIP-seq
MIRT996219	hsa-miR-24	CLIP-seq
MIRT996198	hsa-miR-3151	CLIP-seq
MIRT996220	hsa-miR-3155	CLIP-seq
MIRT996221	hsa-miR-3155b	CLIP-seq
MIRT996222	hsa-miR-3157-5p	CLIP-seq
MIRT996204	hsa-miR-3689d	CLIP-seq
MIRT996223	hsa-miR-3925-3p	CLIP-seq
MIRT996206	hsa-miR-424	CLIP-seq
MIRT996207	hsa-miR-4271	CLIP-seq
MIRT996224	hsa-miR-4518	CLIP-seq
MIRT996225	hsa-miR-4524	CLIP-seq
MIRT996208	hsa-miR-4660	CLIP-seq
MIRT996226	hsa-miR-4691-3p	CLIP-seq
MIRT996209	hsa-miR-4725-3p	CLIP-seq
MIRT996211	hsa-miR-4731-5p	CLIP-seq
MIRT996227	hsa-miR-4755-3p	CLIP-seq
MIRT996228	hsa-miR-484	CLIP-seq
MIRT996213	hsa-miR-497	CLIP-seq
MIRT996229	hsa-miR-503	CLIP-seq
MIRT996230	hsa-miR-646	CLIP-seq
MIRT996231	hsa-miR-766	CLIP-seq
MIRT996189	hsa-miR-15a	CLIP-seq
MIRT996190	hsa-miR-15b	CLIP-seq
MIRT996191	hsa-miR-16	CLIP-seq
MIRT996193	hsa-miR-1909	CLIP-seq
MIRT996194	hsa-miR-195	CLIP-seq
MIRT996197	hsa-miR-214	CLIP-seq
MIRT996204	hsa-miR-3689d	CLIP-seq
MIRT996206	hsa-miR-424	CLIP-seq
MIRT996213	hsa-miR-497	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
IKZF1	Activation	11981041

Show/Hide all(49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA	21873635
GO:0005007	Function	Fibroblast growth factor-activated receptor activity	IBA	21873635
GO:0005007	Function	Fibroblast growth factor-activated receptor activity	IDA	8663044, 18480409, 21653700
GO:0005007	Function	Fibroblast growth factor-activated receptor activity	IGI	10525310
GO:0005515	Function	Protein binding	IPI	17627937, 20798051
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	20683963
GO:0005794	Component	Golgi apparatus	IDA	18061161
GO:0005886	Component	Plasma membrane	IDA	18061161
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	20683963
GO:0005911	Component	Cell-cell junction	IDA	20798051
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007275	Process	Multicellular organism development	IBA	21873635
GO:0008201	Function	Heparin binding	IDA	18480409
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8663044
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IDA	21653700
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	8663044
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10525310
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0010628	Process	Positive regulation of gene expression	IMP	19085950
GO:0010715	Process	Regulation of extracellular matrix disassembly	IMP	20876804
GO:0016477	Process	Cell migration	IMP	20876804
GO:0017134	Function	Fibroblast growth factor binding	IBA	21873635
GO:0017134	Function	Fibroblast growth factor binding	IDA	8663044, 18480409
GO:0017134	Function	Fibroblast growth factor binding	IPI	10525310, 17627937
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	18480409, 20683963
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0030133	Component	Transport vesicle	IDA	18061161
GO:0033674	Process	Positive regulation of kinase activity	IBA	21873635
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0043085	Process	Positive regulation of catalytic activity	IMP	20798051
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0045862	Process	Positive regulation of proteolysis	IMP	20798051
GO:0046777	Process	Protein autophosphorylation	IDA	20798051
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0055062	Process	Phosphate ion homeostasis	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	21653700
GO:0070857	Process	Regulation of bile acid biosynthetic process	IBA	21873635
GO:0070857	Process	Regulation of bile acid biosynthetic process	IMP	17623664, 20683963
GO:1903412	Process	Response to bile acid	IMP	19085950
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IMP	21653700

MIM	HGNC	e!Ensembl
134935	3691	ENSG00000160867

Protein

UniProt ID

P22455

Protein name

Fibroblast growth factor receptor 4 (FGFR-4) (EC 2.7.10.1) (CD antigen CD334)

Protein function

Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays a role in the regulation of cell proliferation, differentiation and migration, and in regulation of lipid metabolism, bile acid biosynthesis, gl

PDB

4QQ5 , 4QQC , 4QQJ , 4QQT , 4QRC , 4R6V , 4TYE , 4TYG , 4TYI , 4TYJ , 4UXQ , 4XCU , 5JKG , 5NUD , 5NWZ , 5XFF , 5XFJ , 6IUO , 6IUP , 6J6Y , 6JPE , 6JPJ , 6NVG , 6NVH , 6NVI , 6NVJ , 6NVK , 6V9C , 6YI8 , 7DTZ , 7F3M , 7N1J , 7TYD , 7V29 , 7VJL , 7WCT , 7WCW , 7WCX , 7YBO , 7YBP , 7YBX , 7YC1 , 7YC3 , 7YSW , 8KH6 , 8KH7 , 8KH8 , 8KH9 , 8W5C , 8XLQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	154 → 241	Immunoglobulin I-set domain	Domain
PF13927	Ig_3	248 → 337		Domain
PF07714	PK_Tyr_Ser-Thr	467 → 743	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in gastrointestinal epithelial cells, pancreas, and gastric and pancreatic cancer cell lines. {ECO:0000269|PubMed:10631118}.

Sequence

MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS
LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS
VFSHDPLPLGSSSFPFGSGVQT

Sequence length

802

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway Endocytosis PI3K-Akt signaling pathway Signaling pathways regulating pluripotency of stem cells Regulation of actin cytoskeleton Pathways in cancer		PI3K Cascade PIP3 activates AKT signaling betaKlotho-mediated ligand binding FGFR4 mutant receptor activation FGFR4 ligand binding and activation Constitutive Signaling by Aberrant PI3K in Cancer Phospholipase C-mediated cascade; FGFR4 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR4 signaling Signaling by FGFR4 in disease RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenoid Cystic Carcinoma	rs121913530, rs886039394, rs121913474	23685749
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	21349172, 15448004, 18756523, 18670643, 20876804
Rhabdomyosarcoma	Rhabdomyosarcoma	rs137854557, rs121909224, rs63751466, rs11540652, rs28934874, rs104894229, rs104894230, rs267606708, rs80357867, rs276174889, rs80359011, rs80358556, rs80359391, rs80357989, rs886037650 View all (19 more)	24124571, 19809159

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Cholelithiasis	Cholelithiasis	GWAS

Show/Hide Text Mining Associations (119)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Inhibit	15016321
Adenocarcinoma	Associate	31527546, 34724890
Adenocarcinoma of Lung	Associate	17487277, 32781755, 34642306
Adrenocortical Carcinoma	Associate	34956100
Alveolar echinococcosis	Associate	24288432
Brain Neoplasms	Associate	27926948
Breast Neoplasms	Associate	14601095, 15377668, 19240166, 20147743, 23226373, 25349422, 26152288, 26431494, 27192118, 27926948, 29763898, 30359238, 32381997, 32710281, 33446698, 33838601, 35562334, 7680645 View all (3 more)
Bronchopulmonary Dysplasia	Associate	24288432
Cap Myopathy	Stimulate	15655558
Carcinogenesis	Associate	12937159, 21567388, 25686244
Carcinoma Basal Cell	Associate	31878098
Carcinoma Hepatocellular	Associate	22309595, 22439738, 24324363, 25860955, 26498355, 27447573, 28069043, 28445152, 31575541, 32555680, 33051476, 33754043, 33794926, 35466502, 36179047 View all (4 more)
Carcinoma Hepatocellular	Stimulate	32677805
Carcinoma Non Small Cell Lung	Associate	23524567, 33407583, 36142417
Carcinoma Ovarian Epithelial	Associate	35513870
Carcinoma Pancreatic Ductal	Associate	34061869, 35963908
Carcinoma Renal Cell	Associate	33668731
Carcinoma Squamous Cell	Associate	27154171, 28583379, 32596330
Cardiovascular Diseases	Associate	33126883
Cerebral Infarction	Associate	23206452
Chemical and Drug Induced Liver Injury	Associate	37895284
Cholangiocarcinoma	Associate	28255027, 28445152, 34981854, 36190545, 36462464, 37817227
Cirrhosis Familial	Associate	36190545
Colorectal Neoplasms	Associate	19638618, 22465712, 22971346, 24503538, 27650548, 27857023, 32533590, 33034614, 36923538, 37083591
Coronary Artery Disease	Associate	22313031
Death	Associate	23226373
Dermatofibrosarcoma	Associate	23614918
Desmoplastic Small Round Cell Tumor	Associate	32393201, 32703985, 33753552
Diabetes Mellitus	Associate	23206452
Diarrhea	Associate	22271411, 37270847
Disease	Associate	23226373
Drug Related Side Effects and Adverse Reactions	Associate	30359238, 37270847
Drug Related Side Effects and Adverse Reactions	Stimulate	32533590
Embolism	Associate	23226373
Endometriosis	Associate	37789421
Esophageal Neoplasms	Associate	25989802
Esophageal Squamous Cell Carcinoma	Associate	25989802
Farber Lipogranulomatosis	Associate	20691689
Fatty Liver	Stimulate	27447573
Fatty Liver	Associate	37895284
Febrile Neutropenia	Associate	24641830
Fibroadenoma	Associate	11271786
Fibrosis	Associate	27447573, 37895284
Fibular hypoplasia and complex brachydactyly	Associate	36462464
Ganglioglioma	Associate	36973520
Gastrointestinal Stromal Tumors	Associate	31948066
Gastroschisis	Associate	31075877
Genetic Diseases Inborn	Associate	23342975, 32532875
Glioma	Associate	36462464
Head and Neck Neoplasms	Associate	23226373, 34768995
Hemangioblastoma	Associate	40393028
Hereditary Breast and Ovarian Cancer Syndrome	Associate	11271786
Histiocytoma Benign Fibrous	Associate	23614918
HIV Infections	Associate	12823281
Huntington Disease	Associate	33049985
Hypercalcemia	Associate	24670087
Hypercalcemia Infantile	Associate	24670087
Hyperphosphatemia	Associate	37270847
Hypertrophy Left Ventricular	Associate	26681731
Ichthyosis X Linked	Associate	30816547
Inflammation	Associate	37895284
Irritable Bowel Syndrome	Associate	21396369, 22271411, 22610000, 24200957
Jaundice	Associate	19596467
Kidney Failure Chronic	Associate	21567388
Leukemia	Associate	1638019
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	28069043
Liver Cirrhosis	Associate	25860955
Liver Neoplasms	Associate	27447573
Lown Ganong Levine Syndrome	Associate	32710281
Lung Neoplasms	Associate	23836671, 32781755
Lung Neoplasms	Stimulate	40547312
Lymphatic Metastasis	Associate	25989802
Lymphatic Metastasis	Inhibit	27154171
Lymphatic Metastasis	Stimulate	28056982, 36142417
Lymphoma B Cell	Associate	21567388
Lymphoma Non Hodgkin	Associate	24248544
Melanoma	Associate	16721364, 21753785
Melanoma Cutaneous Malignant	Associate	19500394
Mesothelioma Malignant	Associate	31527449
Metabolic Diseases	Associate	37895284
Multiple Myeloma	Associate	24870599
Multiple Trauma	Associate	37006072
N syndrome	Associate	23481570
Neoplasm Metastasis	Associate	14601095, 21622724, 22971346, 23481570, 26498355, 27857023, 28056982, 32599983, 32781755, 35513870
Neoplasms	Stimulate	11003564, 15655558, 32533590
Neoplasms	Associate	15016321, 16721364, 1720539, 17487277, 17519899, 19240166, 19500394, 19638618, 20147743, 20798051, 21622724, 22465712, 22971346, 23226373, 23614918 View all (28 more)
Neoplasms	Inhibit	36142417
Nephrocalcinosis	Associate	37559368
Neuroblastoma	Associate	26840079, 37006072
Neurofibrosarcoma	Associate	26993773
Oral Submucous Fibrosis	Associate	38050610
Ovarian Neoplasms	Associate	38154497
Periapical Diseases	Associate	28290616
Personality Disorders	Associate	21622724
Pilomatrixoma	Associate	33099480
Pituitary Neoplasms	Associate	12937159
Prostatic Hyperplasia	Stimulate	15655558
Prostatic Neoplasms	Associate	18670643, 18762813, 21622724, 27640814, 33446698
Prostatic Neoplasms Castration Resistant	Associate	37796107
Rectal Neoplasms	Associate	27650548
Renal Insufficiency Chronic	Associate	26681731
Respiratory Distress Syndrome	Associate	24288432
Respiratory Distress Syndrome Newborn	Associate	24288432
Retinoblastoma	Associate	31207142
Rhabdoid Tumor Predisposition Syndrome 1	Associate	37726478
Rhabdomyosarcoma	Associate	32464274, 32532875, 34095712, 34768995, 34850536, 39368853
Rhabdomyosarcoma Alveolar	Associate	32464274
Rhabdomyosarcoma Embryonal	Associate	25349422
Sarcoma	Associate	14601095, 23226373, 29881993, 38625071
Sarcoma Synovial	Associate	23664540
Sotos Syndrome	Associate	24670087
Squamous Cell Carcinoma of Head and Neck	Associate	23226373, 23481570, 34576070
Stomach Neoplasms	Associate	11003564, 21567388, 23901234, 25684949, 28056982, 32599983, 37945798
Stroke	Associate	23206452
Tertiary Lymphoid Structures	Associate	23901234, 28583379
Thyroid Carcinoma Anaplastic	Associate	28178124
Urinary Bladder Neoplasms	Associate	36462464
Uterine Cervical Neoplasms	Associate	27154171, 32951893, 34951738
Uveal melanoma	Associate	33126538

FGFR4 (fibroblast growth factor receptor 4)