Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	225689
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPK15
Synonyms (NCBI Gene) Gene synonyms aliases	ERK7, ERK8
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.3

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments
MIRT2267218	hsa-miR-185	CLIP-seq
MIRT2267219	hsa-miR-2110	CLIP-seq
MIRT2267220	hsa-miR-3179	CLIP-seq
MIRT2267221	hsa-miR-3202	CLIP-seq
MIRT2267222	hsa-miR-4271	CLIP-seq
MIRT2267223	hsa-miR-4306	CLIP-seq
MIRT2267224	hsa-miR-4644	CLIP-seq
MIRT2267225	hsa-miR-4667-5p	CLIP-seq
MIRT2267226	hsa-miR-4700-5p	CLIP-seq
MIRT2267227	hsa-miR-4725-3p	CLIP-seq
MIRT2267228	hsa-miR-4747-5p	CLIP-seq
MIRT2267229	hsa-miR-637	CLIP-seq
MIRT2453731	hsa-miR-125a-3p	CLIP-seq
MIRT2453732	hsa-miR-4640-5p	CLIP-seq
MIRT2453733	hsa-miR-4726-5p	CLIP-seq
MIRT2453734	hsa-miR-486-3p	CLIP-seq
MIRT2453735	hsa-miR-873	CLIP-seq

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0003400	Process	Regulation of COPII vesicle coating	IMP	24618899
GO:0003682	Function	Chromatin binding	IDA	20733054
GO:0004672	Function	Protein kinase activity	IDA	26595526
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0004707	Function	MAP kinase activity	IDA	11875070
GO:0005515	Function	Protein binding	IPI	16624805, 20733054, 21190936, 22948227, 23455922, 25852190
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	NAS	11875070
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	20638370, 21190936
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	20638370, 21190936
GO:0005776	Component	Autophagosome	IDA	22948227
GO:0005794	Component	Golgi apparatus	IDA	24618899
GO:0005814	Component	Centriole	IDA	29021280
GO:0005911	Component	Cell-cell junction	IDA	29021280
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005930	Component	Axoneme	IDA	29021280
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	19166846
GO:0007029	Process	Endoplasmic reticulum organization	IMP	21847093
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	20638370
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	20733054
GO:0010506	Process	Regulation of autophagy	IDA	22948227
GO:0016301	Function	Kinase activity	IDA	19166846, 20638370, 28842414
GO:0017124	Function	SH3 domain binding	NAS	11875070
GO:0030336	Process	Negative regulation of cell migration	IMP	24618899
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IDA	21531765
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	21531765
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0036064	Component	Ciliary basal body	IDA	29021280
GO:0046777	Process	Protein autophosphorylation	IDA	11875070
GO:0051973	Process	Positive regulation of telomerase activity	IDA	21531765
GO:0051973	Process	Positive regulation of telomerase activity	IMP	21531765
GO:0072687	Component	Meiotic spindle	IEA
GO:0090494	Process	Dopamine uptake	IDA	28842414
GO:1902017	Process	Regulation of cilium assembly	IMP	29021280
GO:1902017	Process	Regulation of cilium assembly	ISS
GO:1904355	Process	Positive regulation of telomere capping	IDA	21531765
GO:1904355	Process	Positive regulation of telomere capping	IMP	21531765
GO:1904491	Process	Protein localization to ciliary transition zone	IMP	29021280
GO:1905188	Process	Positive regulation of metaphase/anaphase transition of meiosis I	IEA
GO:1905832	Process	Positive regulation of spindle assembly	IEA

MIM	HGNC	e!Ensembl
618616	24667	ENSG00000181085

Protein

UniProt ID

Q8TD08

Protein name

Mitogen-activated protein kinase 15 (MAP kinase 15) (MAPK 15) (EC 2.7.11.24) (Extracellular signal-regulated kinase 7) (ERK-7) (Extracellular signal-regulated kinase 8) (ERK-8)

Protein function

Atypical MAPK protein that regulates several process such as autophagy, ciliogenesis, protein trafficking/secretion and genome integrity, in a kinase activity-dependent manner (PubMed:20733054, PubMed:21847093, PubMed:22948227, PubMed:24618899,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	13 → 304	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with a maximal expression in lung and kidney. {ECO:0000269|PubMed:11875070, ECO:0000269|PubMed:16484222}.

Sequence

MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSSGTSREKGPEG
VSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASVQQVPPRLPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLE
GHHV

Sequence length

544

Interactions

View interactions

	KEGG
	IL-17 signaling pathway

MAPK15 (mitogen-activated protein kinase 15)