Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	225689
Gene name	Mitogen-activated protein kinase 15
Gene symbol	MAPK15
Synonyms (NCBI Gene)	ERK7ERK8
Chromosome	8
Chromosome location	8q24.3

Show/Hide all (17)

miRTarBase ID	miRNA	Experiments
MIRT2267218	hsa-miR-185	CLIP-seq
MIRT2267219	hsa-miR-2110	CLIP-seq
MIRT2267220	hsa-miR-3179	CLIP-seq
MIRT2267221	hsa-miR-3202	CLIP-seq
MIRT2267222	hsa-miR-4271	CLIP-seq
MIRT2267223	hsa-miR-4306	CLIP-seq
MIRT2267224	hsa-miR-4644	CLIP-seq
MIRT2267225	hsa-miR-4667-5p	CLIP-seq
MIRT2267226	hsa-miR-4700-5p	CLIP-seq
MIRT2267227	hsa-miR-4725-3p	CLIP-seq
MIRT2267228	hsa-miR-4747-5p	CLIP-seq
MIRT2267229	hsa-miR-637	CLIP-seq
MIRT2453731	hsa-miR-125a-3p	CLIP-seq
MIRT2453732	hsa-miR-4640-5p	CLIP-seq
MIRT2453733	hsa-miR-4726-5p	CLIP-seq
MIRT2453734	hsa-miR-486-3p	CLIP-seq
MIRT2453735	hsa-miR-873	CLIP-seq

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0003400	Process	Regulation of COPII vesicle coating	IMP	24618899
GO:0003682	Function	Chromatin binding	IDA	20733054
GO:0004672	Function	Protein kinase activity	IDA	26595526
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004707	Function	MAP kinase activity	IDA	11875070
GO:0004707	Function	MAP kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16624805, 20733054, 21190936, 22939624, 22948227, 23455922, 25852190, 32707033, 33961781, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	NAS	11875070
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20638370, 21190936
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	20638370, 21190936
GO:0005737	Component	Cytoplasm	IEA
GO:0005776	Component	Autophagosome	IDA	22948227
GO:0005776	Component	Autophagosome	IEA
GO:0005794	Component	Golgi apparatus	IDA	24618899
GO:0005794	Component	Golgi apparatus	IEA
GO:0005814	Component	Centriole	IDA	29021280
GO:0005814	Component	Centriole	IEA
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005911	Component	Cell-cell junction	IDA	29021280
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005930	Component	Axoneme	IDA	29021280
GO:0006974	Process	DNA damage response	IDA	19166846
GO:0007029	Process	Endoplasmic reticulum organization	IMP	21847093
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	20638370
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	20733054
GO:0010506	Process	Regulation of autophagy	IDA	22948227
GO:0016301	Function	Kinase activity	IDA	19166846, 20638370, 28842414
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017124	Function	SH3 domain binding	NAS	11875070
GO:0030336	Process	Negative regulation of cell migration	IMP	24618899
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032206	Process	Positive regulation of telomere maintenance	IDA	21531765
GO:0033554	Process	Cellular response to stress	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0036064	Component	Ciliary basal body	IDA	29021280
GO:0042995	Component	Cell projection	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	21531765
GO:0046777	Process	Protein autophosphorylation	IDA	11875070
GO:0070161	Component	Anchoring junction	IEA
GO:0072687	Component	Meiotic spindle	IEA
GO:0090494	Process	Dopamine uptake	IDA	28842414
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902017	Process	Regulation of cilium assembly	IEA
GO:1902017	Process	Regulation of cilium assembly	IMP	29021280
GO:1902017	Process	Regulation of cilium assembly	ISS
GO:1904491	Process	Protein localization to ciliary transition zone	IMP	29021280
GO:1905188	Process	Positive regulation of metaphase/anaphase transition of meiosis I	IEA
GO:1905832	Process	Positive regulation of spindle assembly	IEA

MIM	HGNC	e!Ensembl
618616	24667	ENSG00000181085

Q8TD08

Protein name

Mitogen-activated protein kinase 15 (MAP kinase 15) (MAPK 15) (EC 2.7.11.24) (Extracellular signal-regulated kinase 7) (ERK-7) (Extracellular signal-regulated kinase 8) (ERK-8)

Protein function

Atypical MAPK protein that regulates several process such as autophagy, ciliogenesis, protein trafficking/secretion and genome integrity, in a kinase activity-dependent manner (PubMed:20733054, PubMed:21847093, PubMed:22948227, PubMed:24618899,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	13 → 304	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with a maximal expression in lung and kidney. {ECO:0000269|PubMed:11875070, ECO:0000269|PubMed:16484222}.

Sequence

MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSSGTSREKGPEG
VSPSQAHLHKPRADPQLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQ
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASVQQVPPRLPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTVCHSALGHLPLLE
GHHV

Sequence length

544

Interactions

View interactions

	KEGG
	IL-17 signaling pathway

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Ovarian serous cystadenocarcinoma	Uncertain significance	rs185466475	RCV005932594

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AIDS Associated Nephropathy	Associate	35642724
Drug Related Side Effects and Adverse Reactions	Associate	28467781
Drug Related Side Effects and Adverse Reactions	Stimulate	38203280
Lung Neoplasms	Associate	28467781
Lymphatic Metastasis	Inhibit	38203280
Neoplasm Metastasis	Associate	26035356
Neoplasms	Associate	26035356, 26291129, 26595526, 38203280
Ovarian Neoplasms	Associate	38203280
Pulmonary Disease Chronic Obstructive	Associate	34224814
Stomach Neoplasms	Associate	26035356

MAPK15 (mitogen-activated protein kinase 15)