Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2247
Gene name Gene Name - the full gene name approved by the HGNC.
Fibroblast growth factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FGF2
Synonyms (NCBI Gene) Gene synonyms aliases
BFGF, FGF-2, FGFB, HBGF-2
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q28.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as lim
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000736 hsa-miR-199a-5p Review 19574400
MIRT000733 hsa-miR-145-5p Review 19574400
MIRT001468 hsa-miR-16-5p pSILAC 18668040
MIRT003962 hsa-miR-140-5p Microarray 17875710
MIRT007223 hsa-miR-503-5p Luciferase reporter assay 23352645
Transcription factors
Transcription factor Regulation Reference
EGR1 Activation 8702507
ERG Repression 12137767
HDAC5 Repression 19351956
HIF1A Activation 19492421
HOXB7 Activation 21183939;8756643
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS
GO:0000187 Process Activation of MAPK activity TAS 9712850
GO:0001658 Process Branching involved in ureteric bud morphogenesis IDA 12631064
GO:0001934 Process Positive regulation of protein phosphorylation IBA 21873635
GO:0001938 Process Positive regulation of endothelial cell proliferation IDA 16756958, 31915155
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
134920 3676 ENSG00000138685
Protein
UniProt ID P09038
Protein name Fibroblast growth factor 2 (FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)
Protein function Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed:8663044). Also acts as an integrin ligand which is required for FGF2 signaling (PubMed:28302677). Binds to integrin ITGAV:ITGB3 (PubMed:28302677). Plays an important role in the regulati
PDB 1BAS , 1BFB , 1BFC , 1BFF , 1BFG , 1BLA , 1BLD , 1CVS , 1EV2 , 1FGA , 1FQ9 , 1II4 , 1IIL , 2BFH , 2FGF , 2M49 , 4FGF , 4OEE , 4OEF , 4OEG , 5X1O , 6L4O , 8HU7 , 8HUE , 8OM6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00167 FGF 162 282 Fibroblast growth factor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. {ECO:0000269|PubMed:1417798, ECO:0000269|PubMed:1721615}.
Sequence
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFL
PMSAKS
Sequence length 288
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Kaposi sarcoma-associated herpesvirus infection
Pathways in cancer
Proteoglycans in cancer
Chemical carcinogenesis - receptor activation
Melanoma
Breast cancer
Gastric cancer
  PI3K Cascade
PIP3 activates AKT signaling
Signaling by activated point mutants of FGFR1
Signaling by activated point mutants of FGFR3
FGFR4 ligand binding and activation
FGFR1b ligand binding and activation
FGFR3c ligand binding and activation
FGFR1c ligand binding and activation
FGFR2c ligand binding and activation
FGFR2b ligand binding and activation
FGFR3 mutant receptor activation
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation
Syndecan interactions
Non-integrin membrane-ECM interactions
Phospholipase C-mediated cascade: FGFR1
Phospholipase C-mediated cascade; FGFR2
Phospholipase C-mediated cascade; FGFR3
Phospholipase C-mediated cascade; FGFR4
Downstream signaling of activated FGFR1
SHC-mediated cascade:FGFR1
PI-3K cascade:FGFR1
FRS-mediated FGFR1 signaling
PI-3K cascade:FGFR2
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
SHC-mediated cascade:FGFR3
FRS-mediated FGFR3 signaling
PI-3K cascade:FGFR3
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
PI-3K cascade:FGFR4
Negative regulation of FGFR1 signaling
Negative regulation of FGFR2 signaling
Negative regulation of FGFR3 signaling
Negative regulation of FGFR4 signaling
Signaling by FGFR2 in disease
Signaling by FGFR1 in disease
FGFRL1 modulation of FGFR1 signaling
RAF/MAP kinase cascade
Interleukin-4 and Interleukin-13 signaling
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Signaling by FGFR3 point mutants in cancer
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Epilepsy Epilepsy, Tonic-Clonic, Familial, Epilepsy, Tonic-Clonic, Symptomatic rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670
View all (165 more)
16023256
Glioma Glioma, mixed gliomas, Malignant Glioma rs121909219, rs121909224, rs587776667, rs587776671, rs121909239, rs121909241, rs28933368, rs121913500, rs55863639, rs786201995, rs786202517, rs786201044, rs398123317, rs1057518425, rs121913499
View all (13 more)
10673511
Kidney disease Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315 8995747
Mesothelioma Mesothelioma rs121907908, rs387906350, rs387906351 15878867
Unknown
Disease term Disease name Evidence References Source
Mental depression Endogenous depression, Depressive disorder, Unipolar Depression, Depressive Syndrome, Depression, Neurotic 16861106 ClinVar
Oligodendroglioma Oligodendroglioma GWAS
Sarcoidosis Sarcoidosis GWAS
Associations from Text Mining
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Stimulate 23988031
Abdominal Pain Associate 10595927
Adenocarcinoma of Lung Associate 18829480, 28533502, 35379924, 38043261
Adenocarcinoma Scirrhous Stimulate 9369936
Adenoma Pleomorphic Associate 11290564, 20379686
Adenoma Pleomorphic Stimulate 21996542
Adenomatous Polyposis Coli Associate 34360002
Allergic Fungal Sinusitis Associate 25561293
Allergic Fungal Sinusitis Stimulate 25624129
Alzheimer Disease Associate 35523454, 37838728