Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2247
Gene name Gene Name - the full gene name approved by the HGNC.	Fibroblast growth factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FGF2
Synonyms (NCBI Gene) Gene synonyms aliases	BFGF, FGF-2, FGFB, HBGF-2
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q28.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as lim

Show/Hide all(974)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000736	hsa-miR-199a-5p	Review	19574400
MIRT000733	hsa-miR-145-5p	Review	19574400
MIRT001468	hsa-miR-16-5p	pSILAC	18668040
MIRT003962	hsa-miR-140-5p	Microarray	17875710
MIRT007223	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT007223	hsa-miR-503-5p	Luciferase reporter assay	23352645
MIRT020683	hsa-miR-155-5p	Proteomics	18668040
MIRT021161	hsa-miR-186-5p	Sequencing	20371350
MIRT024732	hsa-miR-215-5p	Microarray	19074876
MIRT026446	hsa-miR-192-5p	Microarray	19074876
MIRT027141	hsa-miR-103a-3p	Sequencing	20371350
MIRT028310	hsa-miR-32-5p	Sequencing	20371350
MIRT001468	hsa-miR-16-5p	Sequencing	20371350
MIRT001468	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT049684	hsa-miR-92a-3p	CLASH	23622248
MIRT054815	hsa-miR-15b-5p	qRT-PCR	24560946
MIRT211201	hsa-miR-424-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	23263626
MIRT007223	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	23263626
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT438378	hsa-miR-152-3p	Luciferase reporter assay, Western blot	25190353
MIRT724422	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT724421	hsa-miR-1976	HITS-CLIP	19536157
MIRT724420	hsa-miR-3671	HITS-CLIP	19536157
MIRT724419	hsa-miR-607	HITS-CLIP	19536157
MIRT724418	hsa-miR-1305	HITS-CLIP	19536157
MIRT211231	hsa-miR-548c-3p	HITS-CLIP	21572407
MIRT211229	hsa-miR-495-3p	HITS-CLIP	21572407
MIRT211232	hsa-miR-5688	HITS-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	HITS-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	HITS-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	HITS-CLIP	21572407
MIRT211223	hsa-miR-25-3p	HITS-CLIP	21572407
MIRT028310	hsa-miR-32-5p	HITS-CLIP	21572407
MIRT211227	hsa-miR-363-3p	HITS-CLIP	21572407
MIRT211228	hsa-miR-367-3p	HITS-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	HITS-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	HITS-CLIP	21572407
MIRT476870	hsa-miR-759	HITS-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	HITS-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	HITS-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	HITS-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	HITS-CLIP	21572407
MIRT507255	hsa-miR-708-3p	HITS-CLIP	21572407
MIRT211261	hsa-miR-548p	HITS-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	HITS-CLIP	21572407
MIRT211257	hsa-miR-545-3p	HITS-CLIP	21572407
MIRT309159	hsa-miR-936	HITS-CLIP	21572407
MIRT557864	hsa-miR-26b-3p	HITS-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	HITS-CLIP	21572407
MIRT537379	hsa-miR-1206	HITS-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	HITS-CLIP	21572407
MIRT309153	hsa-miR-222-5p	HITS-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	HITS-CLIP	21572407
MIRT537376	hsa-miR-376b-3p	HITS-CLIP	21572407
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211204	hsa-miR-1276	PAR-CLIP	20371350
MIRT211205	hsa-miR-2278	PAR-CLIP	20371350
MIRT211209	hsa-miR-451b	PAR-CLIP	20371350
MIRT211208	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT211206	hsa-miR-3148	PAR-CLIP	20371350
MIRT211207	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT574775	hsa-miR-3153	PAR-CLIP	20371350
MIRT574774	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT574773	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT211202	hsa-miR-450a-1-3p	PAR-CLIP	20371350
MIRT574772	hsa-miR-3122	PAR-CLIP	20371350
MIRT574771	hsa-miR-3913-5p	PAR-CLIP	20371350
MIRT574770	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT574769	hsa-miR-6513-5p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211265	hsa-miR-107	PAR-CLIP	20371350
MIRT027141	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562332	hsa-miR-3607-3p	PAR-CLIP	20371350
MIRT211270	hsa-miR-3686	PAR-CLIP	20371350
MIRT562331	hsa-miR-4659a-3p	PAR-CLIP	20371350
MIRT562330	hsa-miR-4659b-3p	PAR-CLIP	20371350
MIRT557872	hsa-miR-7109-3p	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT557871	hsa-miR-577	PAR-CLIP	21572407
MIRT557870	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT557869	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT557868	hsa-miR-3935	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	PAR-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	PAR-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	PAR-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	21572407
MIRT309159	hsa-miR-936	PAR-CLIP	21572407
MIRT557864	hsa-miR-26b-3p	PAR-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT537379	hsa-miR-1206	PAR-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	21572407
MIRT309153	hsa-miR-222-5p	PAR-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	21572407
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT211229	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT211232	hsa-miR-5688	PAR-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT211223	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028310	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT211227	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT211228	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT476870	hsa-miR-759	PAR-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT211257	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT537389	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT537387	hsa-miR-4643	PAR-CLIP	22012620
MIRT537386	hsa-miR-4729	PAR-CLIP	22012620
MIRT537385	hsa-miR-1284	PAR-CLIP	22012620
MIRT537384	hsa-miR-466	PAR-CLIP	22012620
MIRT211211	hsa-miR-181c-3p	PAR-CLIP	22012620
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT211223	hsa-miR-25-3p	PAR-CLIP	22012620
MIRT028310	hsa-miR-32-5p	PAR-CLIP	22012620
MIRT211227	hsa-miR-363-3p	PAR-CLIP	22012620
MIRT211228	hsa-miR-367-3p	PAR-CLIP	22012620
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	22012620
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	22012620
MIRT476870	hsa-miR-759	PAR-CLIP	22012620
MIRT537383	hsa-miR-302a-5p	PAR-CLIP	22012620
MIRT537382	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	22012620
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT537381	hsa-miR-3529-3p	PAR-CLIP	22012620
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT211238	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT211239	hsa-miR-600	PAR-CLIP	22012620
MIRT537380	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP	22012620
MIRT211261	hsa-miR-548p	PAR-CLIP	22012620
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT211257	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	22012620
MIRT537379	hsa-miR-1206	PAR-CLIP	22012620
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	22012620
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	22012620
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT001468	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT211201	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT211200	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT211203	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211252	hsa-miR-646	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT211195	hsa-miR-562	PAR-CLIP	23446348
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT309156	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT211198	hsa-miR-5697	PAR-CLIP	23446348
MIRT507259	hsa-miR-4310	PAR-CLIP	23446348
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	23446348
MIRT309161	hsa-miR-5695	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507256	hsa-miR-4291	PAR-CLIP	23446348
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT211232	hsa-miR-5688	PAR-CLIP	23446348
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23446348
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23446348
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23446348
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT476870	hsa-miR-759	PAR-CLIP	23446348
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT211232	hsa-miR-5688	PAR-CLIP	23592263
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT476870	hsa-miR-759	PAR-CLIP	23592263
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23592263
MIRT731959	hsa-miR-196a-3p	Microarray, qRT-PCR, Western blot	28317323
MIRT731959	hsa-miR-196a-3p	Microarray, qRT-PCR, Western blot	28317323
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT001468	hsa-miR-16-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot, mice xenograft	26655091
MIRT211200	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28500362
MIRT211200	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	28500362
MIRT211201	hsa-miR-424-5p	qRT-PCR, Western blot	28186136
MIRT211201	hsa-miR-424-5p	qRT-PCR, Western blot	28186136
MIRT021161	hsa-miR-186-5p	Luciferase reporter assay	28213656
MIRT021161	hsa-miR-186-5p	Luciferase reporter assay	28213656
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT211200	hsa-miR-195-5p	ELISA, Luciferase reporter assay	26823724
MIRT732432	hsa-miR-23a-3p	ELISA, Western blotting, Northern blotting, qRT-PCR, Quantitative proteomic approach	33632989
MIRT733848	hsa-miR-877-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32977766
MIRT211200	hsa-miR-195-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33953601
MIRT736271	hsa-miR-96-3p	Western blotting, qRT-PCR	32116694
MIRT724422	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT724421	hsa-miR-1976	HITS-CLIP	19536157
MIRT724420	hsa-miR-3671	HITS-CLIP	19536157
MIRT724419	hsa-miR-607	HITS-CLIP	19536157
MIRT724418	hsa-miR-1305	HITS-CLIP	19536157
MIRT211231	hsa-miR-548c-3p	HITS-CLIP	21572407
MIRT211229	hsa-miR-495-3p	HITS-CLIP	21572407
MIRT211232	hsa-miR-5688	HITS-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	HITS-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	HITS-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	HITS-CLIP	21572407
MIRT211223	hsa-miR-25-3p	HITS-CLIP	21572407
MIRT028310	hsa-miR-32-5p	HITS-CLIP	21572407
MIRT211227	hsa-miR-363-3p	HITS-CLIP	21572407
MIRT211228	hsa-miR-367-3p	HITS-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	HITS-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	HITS-CLIP	21572407
MIRT476870	hsa-miR-759	HITS-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	HITS-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	HITS-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	HITS-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	HITS-CLIP	21572407
MIRT507255	hsa-miR-708-3p	HITS-CLIP	21572407
MIRT211261	hsa-miR-548p	HITS-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	HITS-CLIP	21572407
MIRT211257	hsa-miR-545-3p	HITS-CLIP	21572407
MIRT309159	hsa-miR-936	HITS-CLIP	21572407
MIRT557864	hsa-miR-26b-3p	HITS-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	HITS-CLIP	21572407
MIRT537379	hsa-miR-1206	HITS-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	HITS-CLIP	21572407
MIRT309153	hsa-miR-222-5p	HITS-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	HITS-CLIP	21572407
MIRT537376	hsa-miR-376b-3p	HITS-CLIP	21572407
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211204	hsa-miR-1276	PAR-CLIP	20371350
MIRT211205	hsa-miR-2278	PAR-CLIP	20371350
MIRT211209	hsa-miR-451b	PAR-CLIP	20371350
MIRT211208	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT211206	hsa-miR-3148	PAR-CLIP	20371350
MIRT211207	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT574775	hsa-miR-3153	PAR-CLIP	20371350
MIRT574774	hsa-miR-6733-5p	PAR-CLIP	20371350
MIRT574773	hsa-miR-6739-5p	PAR-CLIP	20371350
MIRT211202	hsa-miR-450a-1-3p	PAR-CLIP	20371350
MIRT574772	hsa-miR-3122	PAR-CLIP	20371350
MIRT574771	hsa-miR-3913-5p	PAR-CLIP	20371350
MIRT574770	hsa-miR-887-5p	PAR-CLIP	20371350
MIRT574769	hsa-miR-6513-5p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT211229	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT211232	hsa-miR-5688	PAR-CLIP	20371350
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT211223	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT028310	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT211227	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT211228	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT476870	hsa-miR-759	PAR-CLIP	20371350
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT211195	hsa-miR-562	PAR-CLIP	20371350
MIRT548232	hsa-miR-6074	PAR-CLIP	20371350
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT309156	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT211198	hsa-miR-5697	PAR-CLIP	20371350
MIRT507259	hsa-miR-4310	PAR-CLIP	20371350
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT309161	hsa-miR-5695	PAR-CLIP	20371350
MIRT507256	hsa-miR-4291	PAR-CLIP	20371350
MIRT507255	hsa-miR-708-3p	PAR-CLIP	20371350
MIRT211261	hsa-miR-548p	PAR-CLIP	20371350
MIRT211257	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT001468	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT211203	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT211201	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT211200	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT007223	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT211265	hsa-miR-107	PAR-CLIP	20371350
MIRT027141	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT562332	hsa-miR-3607-3p	PAR-CLIP	20371350
MIRT211270	hsa-miR-3686	PAR-CLIP	20371350
MIRT562331	hsa-miR-4659a-3p	PAR-CLIP	20371350
MIRT562330	hsa-miR-4659b-3p	PAR-CLIP	20371350
MIRT557872	hsa-miR-7109-3p	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT557871	hsa-miR-577	PAR-CLIP	21572407
MIRT557870	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT557869	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT557868	hsa-miR-3935	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT557867	hsa-miR-199b-3p	PAR-CLIP	21572407
MIRT557866	hsa-miR-199a-3p	PAR-CLIP	21572407
MIRT557865	hsa-miR-3129-5p	PAR-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	21572407
MIRT309159	hsa-miR-936	PAR-CLIP	21572407
MIRT557864	hsa-miR-26b-3p	PAR-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT537379	hsa-miR-1206	PAR-CLIP	21572407
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	21572407
MIRT309153	hsa-miR-222-5p	PAR-CLIP	21572407
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	21572407
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	21572407
MIRT211195	hsa-miR-562	PAR-CLIP	21572407
MIRT548232	hsa-miR-6074	PAR-CLIP	21572407
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT309156	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT211198	hsa-miR-5697	PAR-CLIP	21572407
MIRT507259	hsa-miR-4310	PAR-CLIP	21572407
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	21572407
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT309161	hsa-miR-5695	PAR-CLIP	21572407
MIRT507256	hsa-miR-4291	PAR-CLIP	21572407
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT211229	hsa-miR-495-3p	PAR-CLIP	21572407
MIRT211232	hsa-miR-5688	PAR-CLIP	21572407
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT211223	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028310	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT211227	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT211228	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT476870	hsa-miR-759	PAR-CLIP	21572407
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	21572407
MIRT507255	hsa-miR-708-3p	PAR-CLIP	21572407
MIRT211261	hsa-miR-548p	PAR-CLIP	21572407
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT211257	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT537389	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT537387	hsa-miR-4643	PAR-CLIP	22012620
MIRT537386	hsa-miR-4729	PAR-CLIP	22012620
MIRT537385	hsa-miR-1284	PAR-CLIP	22012620
MIRT537384	hsa-miR-466	PAR-CLIP	22012620
MIRT211211	hsa-miR-181c-3p	PAR-CLIP	22012620
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	22012620
MIRT211223	hsa-miR-25-3p	PAR-CLIP	22012620
MIRT028310	hsa-miR-32-5p	PAR-CLIP	22012620
MIRT211227	hsa-miR-363-3p	PAR-CLIP	22012620
MIRT211228	hsa-miR-367-3p	PAR-CLIP	22012620
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	22012620
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	22012620
MIRT476870	hsa-miR-759	PAR-CLIP	22012620
MIRT537383	hsa-miR-302a-5p	PAR-CLIP	22012620
MIRT537382	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	22012620
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT537381	hsa-miR-3529-3p	PAR-CLIP	22012620
MIRT211237	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT211238	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT211239	hsa-miR-600	PAR-CLIP	22012620
MIRT537380	hsa-miR-582-5p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP	22012620
MIRT211261	hsa-miR-548p	PAR-CLIP	22012620
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT211257	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	22012620
MIRT537379	hsa-miR-1206	PAR-CLIP	22012620
MIRT537378	hsa-miR-6853-3p	PAR-CLIP	22012620
MIRT537377	hsa-miR-376a-3p	PAR-CLIP	22012620
MIRT537376	hsa-miR-376b-3p	PAR-CLIP	22012620
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT001468	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT211201	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT211210	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT211199	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT211200	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT054815	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT211203	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211252	hsa-miR-646	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211257	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT007223	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT211195	hsa-miR-562	PAR-CLIP	23446348
MIRT309162	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT309156	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT211198	hsa-miR-5697	PAR-CLIP	23446348
MIRT507259	hsa-miR-4310	PAR-CLIP	23446348
MIRT507258	hsa-miR-7157-5p	PAR-CLIP	23446348
MIRT507257	hsa-miR-3691-3p	PAR-CLIP	23446348
MIRT309161	hsa-miR-5695	PAR-CLIP	23446348
MIRT211196	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT211197	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT507256	hsa-miR-4291	PAR-CLIP	23446348
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT211232	hsa-miR-5688	PAR-CLIP	23446348
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23446348
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23446348
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23446348
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23446348
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23446348
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23446348
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23446348
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23446348
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23446348
MIRT476870	hsa-miR-759	PAR-CLIP	23446348
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23446348
MIRT507255	hsa-miR-708-3p	PAR-CLIP	23446348
MIRT211261	hsa-miR-548p	PAR-CLIP	23446348
MIRT211264	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT211258	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT211231	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT211229	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT211232	hsa-miR-5688	PAR-CLIP	23592263
MIRT211225	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT211226	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT476871	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT211223	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT028310	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT211227	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT211228	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT049684	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT211230	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT476870	hsa-miR-759	PAR-CLIP	23592263
MIRT476869	hsa-miR-5589-3p	PAR-CLIP	23592263
MIRT995648	hsa-miR-101	CLIP-seq
MIRT995649	hsa-miR-139-5p	CLIP-seq
MIRT995650	hsa-miR-144	CLIP-seq
MIRT995651	hsa-miR-3613-3p	CLIP-seq
MIRT995652	hsa-miR-361-3p	CLIP-seq
MIRT995653	hsa-miR-3617	CLIP-seq
MIRT995654	hsa-miR-3618	CLIP-seq
MIRT995655	hsa-miR-3681	CLIP-seq
MIRT995656	hsa-miR-4267	CLIP-seq
MIRT995657	hsa-miR-4493	CLIP-seq
MIRT995658	hsa-miR-4685-5p	CLIP-seq
MIRT995659	hsa-miR-4704-3p	CLIP-seq
MIRT995660	hsa-miR-4717-3p	CLIP-seq
MIRT995661	hsa-miR-4766-5p	CLIP-seq
MIRT995662	hsa-miR-4796-5p	CLIP-seq
MIRT995663	hsa-miR-548u	CLIP-seq
MIRT995664	hsa-miR-555	CLIP-seq
MIRT995665	hsa-miR-641	CLIP-seq
MIRT995666	hsa-miR-654-3p	CLIP-seq
MIRT995667	hsa-miR-656	CLIP-seq
MIRT1548689	hsa-miR-3163	CLIP-seq
MIRT1548690	hsa-miR-340	CLIP-seq
MIRT995651	hsa-miR-3613-3p	CLIP-seq
MIRT995652	hsa-miR-361-3p	CLIP-seq
MIRT995656	hsa-miR-4267	CLIP-seq
MIRT1548691	hsa-miR-4789-5p	CLIP-seq
MIRT1548692	hsa-miR-610	CLIP-seq
MIRT1548693	hsa-miR-634	CLIP-seq
MIRT1556350	hsa-miR-106a	CLIP-seq
MIRT1556351	hsa-miR-106b	CLIP-seq
MIRT1556352	hsa-miR-17	CLIP-seq
MIRT1556353	hsa-miR-20a	CLIP-seq
MIRT1556354	hsa-miR-20b	CLIP-seq
MIRT1556355	hsa-miR-302a	CLIP-seq
MIRT1556356	hsa-miR-302b	CLIP-seq
MIRT1556357	hsa-miR-302c	CLIP-seq
MIRT1556358	hsa-miR-302d	CLIP-seq
MIRT1556359	hsa-miR-302e	CLIP-seq
MIRT1556360	hsa-miR-372	CLIP-seq
MIRT1556361	hsa-miR-373	CLIP-seq
MIRT1548691	hsa-miR-4789-5p	CLIP-seq
MIRT1556362	hsa-miR-495	CLIP-seq
MIRT1556363	hsa-miR-519d	CLIP-seq
MIRT1556364	hsa-miR-520a-3p	CLIP-seq
MIRT1556365	hsa-miR-520b	CLIP-seq
MIRT1556366	hsa-miR-520c-3p	CLIP-seq
MIRT1556367	hsa-miR-520d-3p	CLIP-seq
MIRT1556368	hsa-miR-520e	CLIP-seq
MIRT1556369	hsa-miR-520f	CLIP-seq
MIRT1556370	hsa-miR-548t	CLIP-seq
MIRT1548692	hsa-miR-610	CLIP-seq
MIRT1556371	hsa-miR-636	CLIP-seq
MIRT1556372	hsa-miR-93	CLIP-seq
MIRT1995242	hsa-miR-129-5p	CLIP-seq
MIRT1995243	hsa-miR-15a	CLIP-seq
MIRT1995244	hsa-miR-15b	CLIP-seq
MIRT1995245	hsa-miR-16	CLIP-seq
MIRT1995246	hsa-miR-195	CLIP-seq
MIRT1995247	hsa-miR-208a	CLIP-seq
MIRT1995248	hsa-miR-208b	CLIP-seq
MIRT1995249	hsa-miR-2113	CLIP-seq
MIRT1995250	hsa-miR-3658	CLIP-seq
MIRT1995251	hsa-miR-3674	CLIP-seq
MIRT1995252	hsa-miR-424	CLIP-seq
MIRT1995253	hsa-miR-4716-5p	CLIP-seq
MIRT1995254	hsa-miR-4732-5p	CLIP-seq
MIRT1995255	hsa-miR-497	CLIP-seq
MIRT1995256	hsa-miR-499-5p	CLIP-seq
MIRT1995257	hsa-miR-599	CLIP-seq
MIRT2229349	hsa-miR-1226	CLIP-seq
MIRT1995242	hsa-miR-129-5p	CLIP-seq
MIRT2229350	hsa-miR-197	CLIP-seq
MIRT1995249	hsa-miR-2113	CLIP-seq
MIRT2229351	hsa-miR-216a	CLIP-seq
MIRT1548689	hsa-miR-3163	CLIP-seq
MIRT2229352	hsa-miR-3185	CLIP-seq
MIRT2229353	hsa-miR-3545-3p	CLIP-seq
MIRT1995251	hsa-miR-3674	CLIP-seq
MIRT2229354	hsa-miR-380	CLIP-seq
MIRT2229355	hsa-miR-4307	CLIP-seq
MIRT2229356	hsa-miR-4475	CLIP-seq
MIRT2229357	hsa-miR-4528	CLIP-seq
MIRT2229358	hsa-miR-4635	CLIP-seq
MIRT2229359	hsa-miR-4680-5p	CLIP-seq
MIRT2229360	hsa-miR-4691-3p	CLIP-seq
MIRT1995254	hsa-miR-4732-5p	CLIP-seq
MIRT2229361	hsa-miR-4733-3p	CLIP-seq
MIRT2229362	hsa-miR-4762-5p	CLIP-seq
MIRT2229363	hsa-miR-483-5p	CLIP-seq
MIRT2229364	hsa-miR-5096	CLIP-seq
MIRT1995257	hsa-miR-599	CLIP-seq
MIRT2387985	hsa-miR-127-5p	CLIP-seq
MIRT995648	hsa-miR-101	CLIP-seq
MIRT2428898	hsa-miR-103a	CLIP-seq
MIRT2428899	hsa-miR-1184	CLIP-seq
MIRT2428900	hsa-miR-1205	CLIP-seq
MIRT2387985	hsa-miR-127-5p	CLIP-seq
MIRT995650	hsa-miR-144	CLIP-seq
MIRT1995243	hsa-miR-15a	CLIP-seq
MIRT1995244	hsa-miR-15b	CLIP-seq
MIRT1995245	hsa-miR-16	CLIP-seq
MIRT1995246	hsa-miR-195	CLIP-seq
MIRT2428901	hsa-miR-200b	CLIP-seq
MIRT2428902	hsa-miR-200c	CLIP-seq
MIRT2428903	hsa-miR-2355-3p	CLIP-seq
MIRT2428904	hsa-miR-2392	CLIP-seq
MIRT2428905	hsa-miR-3121-3p	CLIP-seq
MIRT2428906	hsa-miR-3158-5p	CLIP-seq
MIRT2428907	hsa-miR-3190	CLIP-seq
MIRT2428908	hsa-miR-335	CLIP-seq
MIRT2229353	hsa-miR-3545-3p	CLIP-seq
MIRT995651	hsa-miR-3613-3p	CLIP-seq
MIRT995652	hsa-miR-361-3p	CLIP-seq
MIRT2428909	hsa-miR-3664-5p	CLIP-seq
MIRT2428910	hsa-miR-376a	CLIP-seq
MIRT2428911	hsa-miR-376b	CLIP-seq
MIRT1995252	hsa-miR-424	CLIP-seq
MIRT995656	hsa-miR-4267	CLIP-seq
MIRT2428912	hsa-miR-4275	CLIP-seq
MIRT2428913	hsa-miR-4282	CLIP-seq
MIRT2428914	hsa-miR-429	CLIP-seq
MIRT2428915	hsa-miR-4328	CLIP-seq
MIRT2428916	hsa-miR-4419a	CLIP-seq
MIRT2428917	hsa-miR-4422	CLIP-seq
MIRT2428918	hsa-miR-450b-5p	CLIP-seq
MIRT2428919	hsa-miR-4510	CLIP-seq
MIRT2428920	hsa-miR-4524	CLIP-seq
MIRT2229358	hsa-miR-4635	CLIP-seq
MIRT2229359	hsa-miR-4680-5p	CLIP-seq
MIRT2428921	hsa-miR-4709-3p	CLIP-seq
MIRT2428922	hsa-miR-486-5p	CLIP-seq
MIRT1995255	hsa-miR-497	CLIP-seq
MIRT2428923	hsa-miR-503	CLIP-seq
MIRT2428924	hsa-miR-507	CLIP-seq
MIRT2428925	hsa-miR-513a-3p	CLIP-seq
MIRT1556369	hsa-miR-520f	CLIP-seq
MIRT2428926	hsa-miR-544	CLIP-seq
MIRT2428927	hsa-miR-545	CLIP-seq
MIRT2428928	hsa-miR-557	CLIP-seq
MIRT1548692	hsa-miR-610	CLIP-seq
MIRT1548693	hsa-miR-634	CLIP-seq
MIRT995667	hsa-miR-656	CLIP-seq
MIRT2428929	hsa-miR-671-5p	CLIP-seq
MIRT2428930	hsa-miR-676	CLIP-seq
MIRT2428931	hsa-miR-877	CLIP-seq
MIRT2428932	hsa-miR-935	CLIP-seq
MIRT2437247	hsa-miR-2681	CLIP-seq
MIRT2437248	hsa-miR-3130-3p	CLIP-seq
MIRT2437249	hsa-miR-4252	CLIP-seq
MIRT2437250	hsa-miR-941	CLIP-seq
MIRT2449664	hsa-miR-1254	CLIP-seq
MIRT2449665	hsa-miR-3116	CLIP-seq
MIRT2449666	hsa-miR-4794	CLIP-seq
MIRT2449667	hsa-miR-661	CLIP-seq
MIRT2532897	hsa-miR-1179	CLIP-seq
MIRT2532898	hsa-miR-1207-3p	CLIP-seq
MIRT2532899	hsa-miR-1246	CLIP-seq
MIRT2532900	hsa-miR-1253	CLIP-seq
MIRT2532901	hsa-miR-1261	CLIP-seq
MIRT2532902	hsa-miR-1299	CLIP-seq
MIRT2532903	hsa-miR-154	CLIP-seq
MIRT2532904	hsa-miR-1972	CLIP-seq
MIRT2428901	hsa-miR-200b	CLIP-seq
MIRT2428902	hsa-miR-200c	CLIP-seq
MIRT2229351	hsa-miR-216a	CLIP-seq
MIRT2532905	hsa-miR-24	CLIP-seq
MIRT2437247	hsa-miR-2681	CLIP-seq
MIRT2532906	hsa-miR-3115	CLIP-seq
MIRT2532907	hsa-miR-3120-5p	CLIP-seq
MIRT2437248	hsa-miR-3130-3p	CLIP-seq
MIRT2532908	hsa-miR-3138	CLIP-seq
MIRT2532909	hsa-miR-3160-5p	CLIP-seq
MIRT2229352	hsa-miR-3185	CLIP-seq
MIRT2532910	hsa-miR-3201	CLIP-seq
MIRT2532911	hsa-miR-323-3p	CLIP-seq
MIRT2532912	hsa-miR-33a	CLIP-seq
MIRT2532913	hsa-miR-33b	CLIP-seq
MIRT2532914	hsa-miR-345	CLIP-seq
MIRT2229353	hsa-miR-3545-3p	CLIP-seq
MIRT2532915	hsa-miR-3607-5p	CLIP-seq
MIRT2532916	hsa-miR-3647-3p	CLIP-seq
MIRT2532917	hsa-miR-3651	CLIP-seq
MIRT2532918	hsa-miR-3662	CLIP-seq
MIRT1995251	hsa-miR-3674	CLIP-seq
MIRT995655	hsa-miR-3681	CLIP-seq
MIRT2532919	hsa-miR-371-5p	CLIP-seq
MIRT2229354	hsa-miR-380	CLIP-seq
MIRT2532920	hsa-miR-3909	CLIP-seq
MIRT2532921	hsa-miR-3941	CLIP-seq
MIRT2532922	hsa-miR-410	CLIP-seq
MIRT2437249	hsa-miR-4252	CLIP-seq
MIRT2532923	hsa-miR-4261	CLIP-seq
MIRT2532924	hsa-miR-4263	CLIP-seq
MIRT2532925	hsa-miR-4284	CLIP-seq
MIRT2428914	hsa-miR-429	CLIP-seq
MIRT2532926	hsa-miR-4427	CLIP-seq
MIRT2229356	hsa-miR-4475	CLIP-seq
MIRT2229357	hsa-miR-4528	CLIP-seq
MIRT2532927	hsa-miR-4646-5p	CLIP-seq
MIRT2532928	hsa-miR-4650-5p	CLIP-seq
MIRT2532929	hsa-miR-4662a-3p	CLIP-seq
MIRT2532930	hsa-miR-4662a-5p	CLIP-seq
MIRT2532931	hsa-miR-4672	CLIP-seq
MIRT2532932	hsa-miR-4679	CLIP-seq
MIRT2532933	hsa-miR-4680-3p	CLIP-seq
MIRT2229359	hsa-miR-4680-5p	CLIP-seq
MIRT2532934	hsa-miR-4694-3p	CLIP-seq
MIRT2532935	hsa-miR-4698	CLIP-seq
MIRT2428921	hsa-miR-4709-3p	CLIP-seq
MIRT1995253	hsa-miR-4716-5p	CLIP-seq
MIRT2532936	hsa-miR-4718	CLIP-seq
MIRT2532937	hsa-miR-4719	CLIP-seq
MIRT2532938	hsa-miR-4731-3p	CLIP-seq
MIRT2532939	hsa-miR-4735-5p	CLIP-seq
MIRT2229362	hsa-miR-4762-5p	CLIP-seq
MIRT995661	hsa-miR-4766-5p	CLIP-seq
MIRT2532940	hsa-miR-4769-3p	CLIP-seq
MIRT2532941	hsa-miR-4782-5p	CLIP-seq
MIRT2532942	hsa-miR-4791	CLIP-seq
MIRT2532943	hsa-miR-4795-3p	CLIP-seq
MIRT2532944	hsa-miR-4801	CLIP-seq
MIRT2532945	hsa-miR-491-3p	CLIP-seq
MIRT2532946	hsa-miR-499-3p	CLIP-seq
MIRT2532947	hsa-miR-499a-3p	CLIP-seq
MIRT2532948	hsa-miR-516b	CLIP-seq
MIRT2532949	hsa-miR-548a-3p	CLIP-seq
MIRT2532950	hsa-miR-548e	CLIP-seq
MIRT2532951	hsa-miR-548f	CLIP-seq
MIRT2532952	hsa-miR-548m	CLIP-seq
MIRT2532953	hsa-miR-561	CLIP-seq
MIRT2532954	hsa-miR-576-3p	CLIP-seq
MIRT2532955	hsa-miR-576-5p	CLIP-seq
MIRT2532956	hsa-miR-582-3p	CLIP-seq
MIRT2532957	hsa-miR-587	CLIP-seq
MIRT2532958	hsa-miR-651	CLIP-seq
MIRT2437250	hsa-miR-941	CLIP-seq
MIRT2532959	hsa-miR-943	CLIP-seq
MIRT2532897	hsa-miR-1179	CLIP-seq
MIRT2532898	hsa-miR-1207-3p	CLIP-seq
MIRT2532900	hsa-miR-1253	CLIP-seq
MIRT2680959	hsa-miR-1258	CLIP-seq
MIRT2532901	hsa-miR-1261	CLIP-seq
MIRT2532902	hsa-miR-1299	CLIP-seq
MIRT2532903	hsa-miR-154	CLIP-seq
MIRT2532904	hsa-miR-1972	CLIP-seq
MIRT2437247	hsa-miR-2681	CLIP-seq
MIRT2532906	hsa-miR-3115	CLIP-seq
MIRT2532907	hsa-miR-3120-5p	CLIP-seq
MIRT2437248	hsa-miR-3130-3p	CLIP-seq
MIRT2532908	hsa-miR-3138	CLIP-seq
MIRT2680960	hsa-miR-3149	CLIP-seq
MIRT2532909	hsa-miR-3160-5p	CLIP-seq
MIRT2229352	hsa-miR-3185	CLIP-seq
MIRT2532910	hsa-miR-3201	CLIP-seq
MIRT2532911	hsa-miR-323-3p	CLIP-seq
MIRT2532915	hsa-miR-3607-5p	CLIP-seq
MIRT2532916	hsa-miR-3647-3p	CLIP-seq
MIRT2532917	hsa-miR-3651	CLIP-seq
MIRT2532918	hsa-miR-3662	CLIP-seq
MIRT1995251	hsa-miR-3674	CLIP-seq
MIRT995655	hsa-miR-3681	CLIP-seq
MIRT2229354	hsa-miR-380	CLIP-seq
MIRT2532920	hsa-miR-3909	CLIP-seq
MIRT2532921	hsa-miR-3941	CLIP-seq
MIRT2680961	hsa-miR-409-3p	CLIP-seq
MIRT2532922	hsa-miR-410	CLIP-seq
MIRT2437249	hsa-miR-4252	CLIP-seq
MIRT2532924	hsa-miR-4263	CLIP-seq
MIRT2532926	hsa-miR-4427	CLIP-seq
MIRT2229357	hsa-miR-4528	CLIP-seq
MIRT2532928	hsa-miR-4650-5p	CLIP-seq
MIRT2532930	hsa-miR-4662a-5p	CLIP-seq
MIRT2532931	hsa-miR-4672	CLIP-seq
MIRT2532933	hsa-miR-4680-3p	CLIP-seq
MIRT2229359	hsa-miR-4680-5p	CLIP-seq
MIRT2532935	hsa-miR-4698	CLIP-seq
MIRT2428921	hsa-miR-4709-3p	CLIP-seq
MIRT1995253	hsa-miR-4716-5p	CLIP-seq
MIRT2532936	hsa-miR-4718	CLIP-seq
MIRT2532937	hsa-miR-4719	CLIP-seq
MIRT2532938	hsa-miR-4731-3p	CLIP-seq
MIRT995661	hsa-miR-4766-5p	CLIP-seq
MIRT2532941	hsa-miR-4782-5p	CLIP-seq
MIRT2532942	hsa-miR-4791	CLIP-seq
MIRT2532944	hsa-miR-4801	CLIP-seq
MIRT2532945	hsa-miR-491-3p	CLIP-seq
MIRT2532946	hsa-miR-499-3p	CLIP-seq
MIRT2532947	hsa-miR-499a-3p	CLIP-seq
MIRT2532948	hsa-miR-516b	CLIP-seq
MIRT2532949	hsa-miR-548a-3p	CLIP-seq
MIRT2532950	hsa-miR-548e	CLIP-seq
MIRT2532951	hsa-miR-548f	CLIP-seq
MIRT2532952	hsa-miR-548m	CLIP-seq
MIRT2532953	hsa-miR-561	CLIP-seq
MIRT2680962	hsa-miR-570	CLIP-seq
MIRT2532954	hsa-miR-576-3p	CLIP-seq
MIRT2532955	hsa-miR-576-5p	CLIP-seq
MIRT2437250	hsa-miR-941	CLIP-seq

Transcription factors

Show/Hide all(12)

Transcription factor	Regulation	Reference
EGR1	Activation	8702507
ERG	Repression	12137767
HDAC5	Repression	19351956
HIF1A	Activation	19492421
HOXB7	Activation	21183939;8756643
LMO2	Activation	20955387
PTTG1	Unknown	12213878
STAT1	Activation	23086340
STAT1	Repression	23086340
STAT3	Activation	21418908;23086340
STAT3	Unknown	16540670
TP53	Repression	10029407

Show/Hide all(162)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IDA	12631064
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001759	Process	Organ induction	IEA
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	16756958, 31915155
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	18059339
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IDA	18059339
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IGI	19351956
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	2161540, 10830168
GO:0005125	Function	Cytokine activity	IDA	18059339
GO:0005178	Function	Integrin binding	IDA	28302677
GO:0005515	Function	Protein binding	IPI	9700203, 10490103, 10830168, 11030354, 11075807, 11390973, 11716516, 12717444, 14613973, 16257968, 17086194, 18329368, 20363749, 22267482, 23597562, 23597563, 26267536, 33961781, 35384245
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	10490103
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2161540
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2435575
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0006325	Process	Chromatin organization	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006935	Process	Chemotaxis	TAS
GO:0007165	Process	Signal transduction	NAS	9712850
GO:0007265	Process	Ras protein signal transduction	TAS
GO:0007399	Process	Nervous system development	TAS	9576942
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	18059339, 26451614
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	2161540
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2435575
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IDA	16774925, 17500071, 18059339, 20011604, 31915155
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	2161540, 8663044
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	26451614
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10830168
GO:0009792	Process	Embryo development ending in birth or egg hatching	IEA
GO:0009887	Process	Animal organ morphogenesis	TAS	10903182
GO:0010001	Process	Glial cell differentiation	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	31915155
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	NAS	24463821
GO:0010764	Process	Negative regulation of fibroblast migration	IDA	19577615
GO:0014843	Process	Growth factor dependent regulation of skeletal muscle satellite cell proliferation	IMP	18602469
GO:0019956	Function	Chemokine binding	IPI	11708770
GO:0021762	Process	Substantia nigra development	IEA
GO:0021930	Process	Cerebellar granule cell precursor proliferation	IEA
GO:0021940	Process	Positive regulation of cerebellar granule cell precursor proliferation	IEA
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030214	Process	Hyaluronan catabolic process	IDA	19577615
GO:0030324	Process	Lung development	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0038001	Process	Paracrine signaling	IEA
GO:0038001	Process	Paracrine signaling	ISS
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	NAS	24463821
GO:0042056	Function	Chemoattractant activity	IDA	18059339
GO:0042060	Process	Wound healing	IDA	16756958
GO:0042060	Process	Wound healing	TAS	20011604
GO:0042491	Process	Inner ear auditory receptor cell differentiation	IEA
GO:0042660	Process	Positive regulation of cell fate specification	IDA	18635606
GO:0042802	Function	Identical protein binding	IPI	11708770
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	16756958
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	26451614, 31915155
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	18555217, 20011604, 28302677
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IGI	23263626
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	18555217
GO:0043542	Process	Endothelial cell migration	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045609	Process	Positive regulation of inner ear auditory receptor cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045765	Process	Regulation of angiogenesis	TAS	20011604
GO:0045766	Process	Positive regulation of angiogenesis	IDA	16774925, 20011604, 28302677
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IGI	16774925
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18059339
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046668	Process	Regulation of retinal cell programmed cell death	IEA
GO:0048149	Process	Behavioral response to ethanol	IEA
GO:0048598	Process	Embryonic morphogenesis	TAS	20011604
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0048864	Process	Stem cell development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	20011604
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	20011604, 26451614, 31915155
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	31915155
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IDA	9553078
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060128	Process	Corticotropin hormone secreting cell differentiation	IEA
GO:0060129	Process	Thyroid-stimulating hormone-secreting cell differentiation	IEA
GO:0060563	Process	Neuroepithelial cell differentiation	IEA
GO:0060591	Process	Chondroblast differentiation	IDA	17167778
GO:0060644	Process	Mammary gland epithelial cell differentiation	IEA
GO:0060978	Process	Angiogenesis involved in coronary vascular morphogenesis	IEA
GO:0061045	Process	Negative regulation of wound healing	IDA	19577615
GO:0062072	Function	Histone H3K9me2/3 reader activity	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	17167778
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072089	Process	Stem cell proliferation	NAS	25640183
GO:0090049	Process	Regulation of cell migration involved in sprouting angiogenesis	NAS	24463821
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IDA	28302677
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090722	Function	Receptor-receptor interaction	IDA	24157794
GO:1902748	Process	Positive regulation of lens fiber cell differentiation	IDA	29501879
GO:1902895	Process	Positive regulation of miRNA transcription	NAS	24463821
GO:1902913	Process	Positive regulation of neuroepithelial cell differentiation	IEA
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1903587	Process	Regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	NAS	24463821
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	16756958
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IMP	23469107
GO:1904567	Process	Response to wortmannin	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IGI	23263626
GO:1904977	Process	Lymphatic endothelial cell migration	IEA
GO:1905278	Process	Positive regulation of epithelial tube formation	IDA	31915155
GO:1905330	Process	Regulation of morphogenesis of an epithelium	IEA
GO:1905555	Process	Positive regulation of blood vessel branching	IDA	20123964
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IGI	23263626
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IEA
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	NAS	24463821
GO:2000546	Process	Positive regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IDA	16774925
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IGI	16774925
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IGI	16774925

MIM	HGNC	e!Ensembl
134920	3676	ENSG00000138685

Protein

UniProt ID

P09038

Protein name

Fibroblast growth factor 2 (FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)

Protein function

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed:8663044). Also acts as an integrin ligand which is required for FGF2 signaling (PubMed:28302677). Binds to integrin ITGAV:ITGB3 (PubMed:28302677). Plays an important role in the regulati

PDB

1BAS , 1BFB , 1BFC , 1BFF , 1BFG , 1BLA , 1BLD , 1CVS , 1EV2 , 1FGA , 1FQ9 , 1II4 , 1IIL , 2BFH , 2FGF , 2M49 , 4FGF , 4OEE , 4OEF , 4OEG , 5X1O , 6L4O , 8HU7 , 8HUE , 8OM6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	162 → 282	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. {ECO:0000269|PubMed:1417798, ECO:0000269|PubMed:1721615}.

Sequence

MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Sequence length

288

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Signaling pathways regulating pluripotency of stem cells Regulation of actin cytoskeleton Kaposi sarcoma-associated herpesvirus infection Pathways in cancer Proteoglycans in cancer Chemical carcinogenesis - receptor activation Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling Signaling by activated point mutants of FGFR1 Signaling by activated point mutants of FGFR3 FGFR4 ligand binding and activation FGFR1b ligand binding and activation FGFR3c ligand binding and activation FGFR1c ligand binding and activation FGFR2c ligand binding and activation FGFR2b ligand binding and activation FGFR3 mutant receptor activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation Syndecan interactions Non-integrin membrane-ECM interactions Phospholipase C-mediated cascade: FGFR1 Phospholipase C-mediated cascade; FGFR2 Phospholipase C-mediated cascade; FGFR3 Phospholipase C-mediated cascade; FGFR4 Downstream signaling of activated FGFR1 SHC-mediated cascade:FGFR1 PI-3K cascade:FGFR1 FRS-mediated FGFR1 signaling PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling PI-3K cascade:FGFR3 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Signaling by FGFR2 in disease Signaling by FGFR1 in disease FGFRL1 modulation of FGFR1 signaling RAF/MAP kinase cascade Interleukin-4 and Interleukin-13 signaling PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Signaling by FGFR3 point mutants in cancer

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Long QT Syndrome	long qt syndrome	N/A	N/A	ClinVar
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (339)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Stimulate	23988031
Abdominal Pain	Associate	10595927
Adenocarcinoma of Lung	Associate	18829480, 28533502, 35379924, 38043261
Adenocarcinoma Scirrhous	Stimulate	9369936
Adenoma Pleomorphic	Associate	11290564, 20379686
Adenoma Pleomorphic	Stimulate	21996542
Adenomatous Polyposis Coli	Associate	34360002
Allergic Fungal Sinusitis	Associate	25561293
Allergic Fungal Sinusitis	Stimulate	25624129
Alzheimer Disease	Associate	35523454, 37838728
Aneurysm Ascending Aorta	Associate	40214073
Anterior Wall Myocardial Infarction	Associate	26930482
Aortic Aneurysm Abdominal	Inhibit	27126477
Arthritis	Associate	16320338
Arthritis Juvenile	Associate	38166934
Arthritis Psoriatic	Associate	17204151
Arthritis Rheumatoid	Associate	10817565, 12697740, 1420999, 15334457, 17204151, 27036513, 30767867, 31178673, 8311555
Arthritis Rheumatoid	Stimulate	34983591
Ascites	Inhibit	21203522
Asthma	Associate	15223860, 23239497, 40052882
Asthma	Stimulate	25624129, 38253462
Astrocytoma	Associate	1938597, 8835763
Atherosclerosis	Associate	20455997, 2298919
Autoimmune Diseases	Associate	12697740
Biliary Atresia	Associate	34392560
Bipolar Disorder	Associate	29257106
Bisphosphonate Associated Osteonecrosis of the Jaw	Stimulate	40076479
Bone Diseases	Associate	28653999
Bone Diseases Metabolic	Associate	26332075
Brain Injuries Diffuse	Associate	37960778
Brain Ischemia	Associate	14981457
Brain Neoplasms	Associate	18292095, 19018263, 1938597, 28691414
Breast Diseases	Associate	36430763
Breast Neoplasms	Associate	10442194, 10862617, 11454708, 11786412, 14680499, 17317033, 20339243, 21266348, 23468877, 23912956, 24829459, 25287138, 26125705, 27852068, 28045923 View all (13 more)
Breast Neoplasms	Inhibit	10473868, 38189813
Breast Neoplasms	Stimulate	33019728
Bronchiolitis Obliterans Syndrome	Stimulate	20654580
Bronchitis Chronic	Stimulate	16510460
Bronchopulmonary Dysplasia	Associate	37090732
Calcinosis	Inhibit	35714127
Calcinosis Cutis	Associate	10735511, 11891198
Carcinogenesis	Associate	15581609
Carcinoma Basal Cell	Stimulate	15610530
Carcinoma Basal Cell	Associate	22895562
Carcinoma Ductal Breast	Associate	9369936
Carcinoma Embryonal	Associate	1905574
Carcinoma Endometrioid	Associate	22617129
Carcinoma Hepatocellular	Associate	15460907, 21099350, 24495874, 2538817, 26420968, 28454092, 32704163, 37432067, 37489553
Carcinoma Intraductal Noninfiltrating	Associate	32050925
Carcinoma Non Small Cell Lung	Associate	11556841, 11742492, 1718163, 18829480, 18849352, 19204576, 19318994, 23536707, 25190353, 26020126, 28558758, 30589033, 32319650, 35164915
Carcinoma Ovarian Epithelial	Associate	24374756
Carcinoma Renal Cell	Associate	15868953, 16080018, 32229735, 39754169, 7753843
Carcinoma Skin Appendage	Associate	33993866
Carcinoma Squamous Cell	Associate	22732006, 26617686, 9562977
Cardiomyopathies	Associate	37833902
Cardiomyopathy Dilated	Associate	16095497
Cardiomyopathy Hypertrophic	Stimulate	23519824
Carotid Stenosis	Associate	15177237, 20455997
Cartilage Diseases	Associate	18705695
Chemical and Drug Induced Liver Injury	Associate	22839096, 28916723
Chondrosarcoma	Associate	11140704, 19734846, 9665469
Chondrosarcoma	Inhibit	27229532
Chordoma	Associate	24445144, 32011476
Choroidal Neovascularization	Associate	32143276
Choroideremia	Inhibit	20027300
Chronic Limb Threatening Ischemia	Associate	14981457
Clear cell metastatic renal cell carcinoma	Associate	1938597
Cleft Lip	Associate	22074045
Cognitive Dysfunction	Associate	27967316, 37686198
Colitis Ulcerative	Associate	17260007
Colonic Neoplasms	Associate	26133168
Colorectal Neoplasms	Associate	16554912, 17260007, 22547830, 24023735, 25216410, 25973543, 28629469, 28749961, 31758153, 32564470, 33573134, 35941638, 36890467, 37090726
Colorectal Neoplasms	Stimulate	20331620
Conjunctivitis Allergic	Associate	26989694
Contracture	Associate	31467177
Coronary Artery Disease	Inhibit	31886261
Coronary Restenosis	Associate	15531203
COVID 19	Associate	32920756
Coxa Magna	Associate	18991344
Crohn Disease	Associate	25267953
Cystic Fibrosis	Associate	17382901
Cytokine Release Syndrome	Stimulate	20824797
Deafness	Associate	19290024
Death	Inhibit	22617129
Death Sudden Cardiac	Associate	18758635
Depressive Disorder Major	Inhibit	34667146
Dermatitis Contact	Associate	27206134
Dermatofibrosarcoma	Associate	23614918
Diabetes Gestational	Stimulate	20144210
Diabetes Gestational	Associate	27606810
Diabetes Mellitus	Associate	19930868, 25287126, 27237708, 35778435
Diabetes Mellitus Type 2	Associate	17473387, 19930868, 29472102
Diabetic Angiopathies	Associate	19930868
Diabetic Nephropathies	Stimulate	19279131
Diabetic Nephropathies	Associate	36726458
Disease	Stimulate	21440843
Disease	Inhibit	32979454
Disease	Associate	37890888
Drug Related Side Effects and Adverse Reactions	Stimulate	10452107, 10473868
Drug Related Side Effects and Adverse Reactions	Associate	16475708
Dupuytren Contracture	Associate	26018562
Encephalitis	Associate	28342868
Endometrial Neoplasms	Associate	16905765, 20092633, 22617129, 8685603
Epidermolysis Bullosa Dystrophica	Stimulate	9562977
Epidermolysis Bullosa Simplex	Stimulate	9562977
Epiphyseal dysplasia multiple 1	Associate	18705695
Epiretinal Membrane	Associate	9486038
Esophageal Neoplasms	Associate	15810091, 20197313, 24777337, 26487184, 27317650
Esophageal Squamous Cell Carcinoma	Stimulate	24777337
Esophageal Squamous Cell Carcinoma	Associate	26487184, 26857264, 27317650, 28927233, 33381388, 33650665
External Auditory Canal Bilateral Atresia Of With Congenital Vertical Talus	Associate	15875782
Familial Primary Pulmonary Hypertension	Stimulate	21037114
Fetal Growth Retardation	Stimulate	20412591
Fibrosis	Associate	10411682, 11168939, 12689941, 1695484, 24827991, 25309050, 31630548, 31974428
Fibrosis	Stimulate	16316338
Fibrosis	Inhibit	25948488, 26351640
Fractures Bone	Stimulate	24967368
Fractures Bone	Associate	33034913
Fundus Dystrophy Pseudoinflammatory Of Sorsby	Associate	32143276
Gallbladder Diseases	Associate	26111189
Gastrointestinal Stromal Tumors	Associate	25432174
Gerodermia osteodysplastica	Associate	25309050
Giant Cell Arteritis	Associate	34204585
Glioblastoma	Associate	19018263, 1938597, 26056081, 26282129, 33824275, 38218875
Glioblastoma	Stimulate	21906308
Glioma	Associate	1845992, 20074329, 21906308, 23630597, 27189511, 8637898
Glomerulosclerosis Focal Segmental	Stimulate	8995734
Glycosuria Renal	Associate	11168939, 19279131
Goiter	Associate	9625444
Goiter Nodular	Associate	9625444
Granulosa cell tumor of the ovary	Associate	23071632
Graves Ophthalmopathy	Associate	32176314
Head and Neck Neoplasms	Associate	20443891
Hearing Loss	Associate	23512073
Heart Diseases	Associate	25948488
Hemangioma	Associate	22302773, 28928430, 7545872
Hemochromatosis	Stimulate	23512073
Hepatitis C	Stimulate	20483710
Hereditary Breast and Ovarian Cancer Syndrome	Associate	37095445
Heterotaxy Syndrome	Associate	26111189
Histiocytoma Benign Fibrous	Associate	23614918
HIV Infections	Associate	34125285
Hodgkin Disease	Associate	23988031, 24141626
Hyperglycemia	Stimulate	19279131
Hyperglycemia	Inhibit	27606810
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	26800359
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	27606810
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	37240180
Hyperostosis corticalis deformans juvenilis	Associate	32527320
Hyperplasia	Associate	11380837, 12746216
Hypertension	Stimulate	39595551
Hypertension Pulmonary	Associate	21037114
Hypertrophy	Associate	2298919
Hypertrophy	Stimulate	23519824, 24827991
Hypogonadism	Inhibit	30629183
Hypothyroidism	Inhibit	33600668
Hypoxia	Associate	11023511, 19328625, 32920756
Hypoxia	Stimulate	16399861, 18234850
Hypoxia Brain	Stimulate	16304044, 26848616
Ichthyosis X Linked	Associate	21733164
Idiopathic Noncirrhotic Portal Hypertension	Associate	32979454
Idiopathic Pulmonary Fibrosis	Associate	32126996
IgA Vasculitis	Associate	10817565
Immunodeficiency due to Defect in MAPBP Interacting Protein	Inhibit	38017409
Infections	Stimulate	11258803
Infections	Associate	35546010
Inflammation	Associate	11565192, 15166270, 23428978, 25309050, 27057540, 27412348, 32920756, 35523454, 35546010, 37240180, 39929713, 40011933, 40076479
Inflammation	Inhibit	12057924, 26351640
Inflammatory Bowel Diseases	Associate	36726458
Intermittent Claudication	Associate	19775917
Intervertebral Disc Degeneration	Associate	15980999, 33764282
Intervertebral Disc Displacement	Associate	15980999
Intraabdominal Infections	Associate	31480453
Ischemic Stroke	Associate	35673992
Keloid	Associate	30372829
Keratoconus	Associate	25699261
Kidney Diseases	Associate	10469357, 34125285
Kidney Neoplasms	Associate	25890121
Kimura Disease	Associate	9625444
Laryngeal Diseases	Associate	35513993
Lead Poisoning Nervous System	Associate	20618400
Leiomyomatosis	Associate	15762960
Leukemia	Associate	11964307, 31135968, 33924850
Leukemia	Stimulate	22351562
Leukemia Biphenotypic Acute	Associate	16266864
Leukemia Hairy Cell	Associate	10419901, 12689941
Leukemia Lymphocytic Chronic B Cell	Associate	11380405, 12614205, 32585853
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22351562, 24408322
Leukemia Myeloid Acute	Associate	11994978, 12404286, 27671675
Leukemia Myeloid Acute	Stimulate	14530810
Leukocytosis	Associate	22965887
Leukoplakia	Associate	36444596
Liver Cirrhosis	Inhibit	28916723, 32979454
Liver Failure	Inhibit	32979454
Liver Failure Acute	Associate	32979454
Lumbar Stenosis Familial	Associate	23519824
Lung Diseases	Associate	25476248
Lung Diseases Interstitial	Stimulate	31732480
Lung Injury	Inhibit	32920756
Lung Neoplasms	Associate	18829480
Lymphatic Metastasis	Stimulate	15810091
Lymphatic Metastasis	Associate	16554912, 25216410, 33381388
Lymphoma	Associate	14530810
Lymphoma Large B Cell Diffuse	Associate	36263003
Lymphoma Non Hodgkin	Associate	10477738, 23998120
Lymphoma Primary Effusion	Associate	9516148
Macular Degeneration	Associate	21106043, 32143276
Malignant mesenchymal tumor	Associate	19802384
Medulloblastoma	Associate	32818841
Melanoma	Associate	10417628, 16309232, 16685268, 16867222, 19438723, 19478386, 2002252, 2056188, 24725364, 25560632, 26035829, 2684645, 28928360, 8311116, 8756643, 9579548 View all (1 more)
Melanoma	Stimulate	21753785
Melanoma Cutaneous Malignant	Associate	11914215
Meningioma	Associate	1938597
Mesothelioma Malignant	Associate	15878867, 17825301
Mouth Diseases	Stimulate	26465941
Moyamoya Disease	Associate	21440843
Multiple Amputations Traumatic	Associate	27237708
Multiple Myeloma	Associate	12517814, 14530810, 16278310, 19286672, 26909624
Musculoskeletal Diseases	Associate	33034913
Myelodysplastic Myeloproliferative Diseases	Stimulate	14530810
Myocardial Ischemia	Associate	10929776
Myocardial Stunning	Associate	18758635
Myopathies Structural Congenital	Associate	36189305
Myopia	Associate	19710942
Nasal Polyps	Associate	25561293
Neoplasm Invasiveness	Stimulate	33824275
Neoplasm Metastasis	Associate	10442194, 15810091, 16080018, 16867222, 19533745, 20606682, 25403884, 26214645, 26650737, 26823724, 27229532, 34271943, 34983591, 8685603
Neoplasm Metastasis	Stimulate	11159211
Neoplasms	Associate	10187827, 10442194, 11759110, 11891198, 11914215, 12202907, 12404286, 15166270, 15460907, 15810091, 15868953, 16080018, 17166398, 17695471, 17949478 View all (71 more)
Neoplasms	Inhibit	12057924, 1380281, 31911892
Neoplasms	Stimulate	14504053, 16278310, 17317033, 25432174, 29433373, 36639835
Nerve Degeneration	Inhibit	20618400
Neurilemmoma	Associate	1938597
Neuroblastoma	Associate	1314950, 19540207, 21506108, 24216509, 26848616, 31135968
Neurocytoma	Associate	17135416
Neurodegenerative Diseases	Associate	37960778
Neuroma Acoustic	Associate	23512073
Nevus	Associate	10417628, 16309232, 8440904, 9579548
Nevus Pigmented	Associate	2684645
Niemann Pick Disease Type C	Associate	19247499
Non alcoholic Fatty Liver Disease	Associate	37156902
Non Muscle Invasive Bladder Neoplasms	Stimulate	22895562
Nonseminomatous germ cell tumor	Stimulate	14504053
Nose Diseases	Associate	25561293
Obesity	Associate	1401060, 26879180
Obesity	Stimulate	33019728
Orofacial Cleft 1	Associate	26561393, 27511275
Osteitis Deformans	Associate	19556344
Osteoarthritis	Stimulate	17311929
Osteoporosis	Associate	20641033, 28653999
Osteosarcoma	Associate	12393937, 22009965, 25403884, 28619014, 38217543
Otofaciocervical Syndrome	Associate	26561393
Ovarian Diseases	Associate	19456219
Ovarian Neoplasms	Associate	17437011, 19456219, 20645833, 23554977, 24146310, 31522033, 34268918
Ovarian Neoplasms	Inhibit	24374756
Paget Disease Extramammary	Associate	26045818
Pain	Associate	23864770
Pancreatic Neoplasms	Associate	11401320, 14521721, 15155719, 18592007, 21263190, 24503018, 25118635, 9802880
Pancreatitis	Associate	20495748
Pancreatitis Chronic	Associate	20495748
Pancreatitis Chronic	Stimulate	7507297
Parathyroid Diseases	Associate	1362401
Periodontitis	Associate	37240180
Peripheral Vascular Diseases	Associate	19652467
Peripheral Vascular Diseases	Inhibit	25287126
Peritoneal Fibrosis	Associate	10595927
Peritoneal Neoplasms	Associate	10595927
Peritonitis	Associate	10595927
Personality Disorders	Associate	20495748
Phenylketonurias	Associate	25905460
Pituitary Neoplasms	Associate	1938597, 28656882
Polycythemia Vera	Associate	22965887
Pre Eclampsia	Stimulate	31154903
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	30755670
Primary Myelofibrosis	Associate	8977245
Prostatic Hyperplasia	Stimulate	11438462
Prostatic Neoplasms	Associate	10638964, 15274358, 16940294, 19597471, 26650737
Prostatic Neoplasms	Stimulate	29408056
Psoriasis	Associate	17204151, 8103271
Pulmonary Arterial Hypertension	Associate	32126996
Pulmonary Disease Chronic Obstructive	Stimulate	12397010
Pulmonary Fibrosis	Associate	37583315
Radiation Injuries	Associate	26351640
Renal Insufficiency Chronic	Associate	32046176, 34125285
Retinoblastoma	Associate	10229675
Rhabdomyosarcoma	Associate	7577472
Rotator Cuff Injuries	Associate	11565192
Rubella	Associate	35178133
Salter Harris Fractures	Associate	16400016
Sarcoma Ewing	Associate	18263590, 20606682, 2824563
Sarcoma Kaposi	Associate	1987771, 2199583
Scleroderma Systemic	Associate	24141615, 27054717, 31178673, 36707842
Seizures	Inhibit	20618400
Sertoli Leydig Cell Tumor	Stimulate	29433373
Skin Diseases	Associate	8103271
Small Cell Lung Carcinoma	Associate	11815602, 14560006, 16810323, 18401527
Smooth Muscle Tumor	Associate	21037114
Solitary Fibrous Tumors	Associate	11598621
Spinal Cord Injuries	Associate	33595805
Spondylitis Ankylosing	Associate	17204151
Squamous Cell Carcinoma of Head and Neck	Associate	18283272, 18836279, 19385965
Squamous Cell Carcinoma of Head and Neck	Stimulate	26465941
Stomach Diseases	Associate	32630408
Stomach Neoplasms	Associate	15581609, 15929172, 19294533, 19533745, 26769141, 26857264, 28122360, 31789423, 32633361, 36189305, 37496999
Stomach Ulcer	Associate	9824581
Stroke	Associate	35673992
Subarachnoid Hemorrhage	Associate	38173028
Teratocarcinoma	Associate	1312020
Tertiary Lymphoid Structures	Stimulate	22617129
Testicular Neoplasms	Associate	14504053
Thanatophoric Dysplasia Type I	Associate	9582336
Thrombocythemia Essential	Stimulate	15682418
Thymoma	Associate	12049674
Thyroid Cancer Papillary	Stimulate	20306451, 28178124
Thyroid Cancer Papillary	Associate	32590739
Thyroid Carcinoma Anaplastic	Stimulate	28178124
Thyroid Carcinoma Anaplastic	Associate	29924913
Thyroid Diseases	Associate	9625444
Thyroid Neoplasms	Associate	20306451, 21268135, 31717665, 9625444
Thyroid Nodule	Associate	32590739
Tongue Neoplasms	Associate	36639835
Tooth Resorption	Associate	15334457
Trigeminal Neuralgia	Inhibit	34067581
Triple Negative Breast Neoplasms	Associate	26141457, 33946884
Ulcer	Associate	22688339
Ulcer	Stimulate	9824581
Urinary Bladder Neoplasms	Associate	10452107, 19822079, 22895562
Uterine Cervical Neoplasms	Associate	12189553, 17986855, 19352388, 32977766
Uterine Cervical Neoplasms	Stimulate	27966750
Uveal melanoma	Associate	11914215, 32957329
Uveitis	Stimulate	33639877
Vascular Diseases	Associate	25287126
Vascular Diseases	Inhibit	26351640
Vascular Ring	Associate	23519824
Venous Thrombosis	Associate	32156832
Ventricular Remodeling	Associate	24827991
Virus Diseases	Associate	32920756
Vocal Cord Paralysis	Associate	35513993
Warburg Sjo Fledelius syndrome	Associate	25287126

FGF2 (fibroblast growth factor 2)