Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	2246
Gene name	Fibroblast growth factor 1
Gene symbol	FGF1
Synonyms (NCBI Gene)	AFGFECGFECGF-betaECGFAECGFBFGF-1FGF-alphaFGFAGLIO703HBGF-1HBGF1
Chromosome	5
Chromosome location	5q31.3
Summary	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

155

Show/Hide all (155)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022188	hsa-miR-124-3p	Microarray	18668037
MIRT025666	hsa-miR-7-5p	Microarray	17612493
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT717736	hsa-miR-1295b-5p	HITS-CLIP	19536157
MIRT717735	hsa-miR-1912	HITS-CLIP	19536157
MIRT717734	hsa-miR-4773	HITS-CLIP	19536157
MIRT717733	hsa-miR-500b-3p	HITS-CLIP	19536157
MIRT717732	hsa-miR-589-3p	HITS-CLIP	19536157
MIRT717731	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT717730	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT717729	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT717728	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT446188	hsa-miR-4513	PAR-CLIP	22100165
MIRT446187	hsa-miR-6855-3p	PAR-CLIP	22100165
MIRT446186	hsa-miR-6857-3p	PAR-CLIP	22100165
MIRT446185	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446184	hsa-miR-3136-5p	PAR-CLIP	22100165
MIRT446183	hsa-miR-4439	PAR-CLIP	22100165
MIRT446182	hsa-miR-943	PAR-CLIP	22100165
MIRT731763	hsa-miR-326	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26183397
MIRT731763	hsa-miR-326	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26183397
MIRT732611	hsa-miR-150-3p	qRT-PCR	33909697
MIRT732613	hsa-miR-199a-3p	qRT-PCR	33909697
MIRT732617	hsa-miR-320a	qRT-PCR	33909697
MIRT736193	hsa-miR-18a-5p	Luciferase reporter assayWestern blottingqRT-PCR	32210827
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT717736	hsa-miR-1295b-5p	HITS-CLIP	19536157
MIRT717735	hsa-miR-1912	HITS-CLIP	19536157
MIRT717734	hsa-miR-4773	HITS-CLIP	19536157
MIRT717733	hsa-miR-500b-3p	HITS-CLIP	19536157
MIRT717732	hsa-miR-589-3p	HITS-CLIP	19536157
MIRT717731	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT717730	hsa-miR-302b-5p	HITS-CLIP	19536157
MIRT717729	hsa-miR-302d-5p	HITS-CLIP	19536157
MIRT717728	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT710282	hsa-miR-7109-3p	HITS-CLIP	19536157
MIRT710281	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT710280	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT710279	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT710278	hsa-miR-6728-3p	HITS-CLIP	19536157
MIRT710277	hsa-miR-6069	HITS-CLIP	19536157
MIRT446188	hsa-miR-4513	PAR-CLIP	22100165
MIRT446187	hsa-miR-6855-3p	PAR-CLIP	22100165
MIRT446186	hsa-miR-6857-3p	PAR-CLIP	22100165
MIRT446185	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446184	hsa-miR-3136-5p	PAR-CLIP	22100165
MIRT446183	hsa-miR-4439	PAR-CLIP	22100165
MIRT446182	hsa-miR-943	PAR-CLIP	22100165
MIRT995518	hsa-miR-148a	CLIP-seq
MIRT995519	hsa-miR-148b	CLIP-seq
MIRT995520	hsa-miR-152	CLIP-seq
MIRT995521	hsa-miR-1913	CLIP-seq
MIRT995522	hsa-miR-298	CLIP-seq
MIRT995523	hsa-miR-3134	CLIP-seq
MIRT995524	hsa-miR-3158-5p	CLIP-seq
MIRT995525	hsa-miR-3192	CLIP-seq
MIRT995526	hsa-miR-324-3p	CLIP-seq
MIRT995527	hsa-miR-3713	CLIP-seq
MIRT995528	hsa-miR-4264	CLIP-seq
MIRT995529	hsa-miR-4313	CLIP-seq
MIRT995530	hsa-miR-4314	CLIP-seq
MIRT995531	hsa-miR-4418	CLIP-seq
MIRT995532	hsa-miR-4473	CLIP-seq
MIRT995533	hsa-miR-4496	CLIP-seq
MIRT995534	hsa-miR-4534	CLIP-seq
MIRT995535	hsa-miR-4646-5p	CLIP-seq
MIRT995536	hsa-miR-4789-5p	CLIP-seq
MIRT995537	hsa-miR-4797-3p	CLIP-seq
MIRT995538	hsa-miR-509-3-5p	CLIP-seq
MIRT995539	hsa-miR-509-5p	CLIP-seq
MIRT995540	hsa-miR-512-3p	CLIP-seq
MIRT995541	hsa-miR-515-3p	CLIP-seq
MIRT995542	hsa-miR-519e	CLIP-seq
MIRT995543	hsa-miR-520f	CLIP-seq
MIRT995544	hsa-miR-550a	CLIP-seq
MIRT995545	hsa-miR-629	CLIP-seq
MIRT995546	hsa-miR-873	CLIP-seq
MIRT995547	hsa-miR-1343	CLIP-seq
MIRT995521	hsa-miR-1913	CLIP-seq
MIRT995548	hsa-miR-1976	CLIP-seq
MIRT995522	hsa-miR-298	CLIP-seq
MIRT995523	hsa-miR-3134	CLIP-seq
MIRT995549	hsa-miR-3153	CLIP-seq
MIRT995524	hsa-miR-3158-5p	CLIP-seq
MIRT995550	hsa-miR-320b	CLIP-seq
MIRT995551	hsa-miR-320c	CLIP-seq
MIRT995552	hsa-miR-320d	CLIP-seq
MIRT995526	hsa-miR-324-3p	CLIP-seq
MIRT995529	hsa-miR-4313	CLIP-seq
MIRT995531	hsa-miR-4418	CLIP-seq
MIRT995553	hsa-miR-4429	CLIP-seq
MIRT995534	hsa-miR-4534	CLIP-seq
MIRT995535	hsa-miR-4646-5p	CLIP-seq
MIRT995554	hsa-miR-4668-5p	CLIP-seq
MIRT995538	hsa-miR-509-3-5p	CLIP-seq
MIRT995539	hsa-miR-509-5p	CLIP-seq
MIRT995555	hsa-miR-522	CLIP-seq
MIRT995556	hsa-miR-1245b-3p	CLIP-seq
MIRT995557	hsa-miR-1270	CLIP-seq
MIRT995558	hsa-miR-136	CLIP-seq
MIRT995559	hsa-miR-21	CLIP-seq
MIRT995560	hsa-miR-2355-5p	CLIP-seq
MIRT995561	hsa-miR-3174	CLIP-seq
MIRT995562	hsa-miR-361-5p	CLIP-seq
MIRT995563	hsa-miR-4531	CLIP-seq
MIRT995564	hsa-miR-4683	CLIP-seq
MIRT995536	hsa-miR-4789-5p	CLIP-seq
MIRT995565	hsa-miR-590-5p	CLIP-seq
MIRT995566	hsa-miR-620	CLIP-seq
MIRT1548684	hsa-miR-128	CLIP-seq
MIRT1548685	hsa-miR-27a	CLIP-seq
MIRT1548686	hsa-miR-27b	CLIP-seq
MIRT1548687	hsa-miR-342-3p	CLIP-seq
MIRT1548688	hsa-miR-513a-3p	CLIP-seq
MIRT2229333	hsa-miR-193a-3p	CLIP-seq
MIRT2229334	hsa-miR-193b	CLIP-seq
MIRT2229335	hsa-miR-214	CLIP-seq
MIRT2229336	hsa-miR-3194-5p	CLIP-seq
MIRT2229337	hsa-miR-3619-5p	CLIP-seq
MIRT2229338	hsa-miR-4291	CLIP-seq
MIRT2229339	hsa-miR-4435	CLIP-seq
MIRT2229340	hsa-miR-4463	CLIP-seq
MIRT2229341	hsa-miR-4494	CLIP-seq
MIRT2229342	hsa-miR-761	CLIP-seq
MIRT995546	hsa-miR-873	CLIP-seq
MIRT2229343	hsa-miR-922	CLIP-seq
MIRT2387984	hsa-miR-513b	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
PPARG	Unknown	22522926
RFX1	Unknown	20189986;22415835
RFX2	Unknown	22415835
RFX3	Unknown	22415835
STAT3	Repression	14673954

Show/Hide all (74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001759	Process	Organ induction	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IMP	18441324
GO:0005104	Function	Fibroblast growth factor receptor binding	IPI	10830168, 12815063
GO:0005178	Function	Integrin binding	IDA	18441324
GO:0005515	Function	Protein binding	IPI	10618369, 10830168, 11069186, 14613973, 14732692, 18441324, 23597563, 25241761, 32296183, 33961781
GO:0005576	Component	Extracellular region	IDA	12746488
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18400376
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12746488
GO:0005829	Component	Cytosol	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007165	Process	Signal transduction	NAS	3778488
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	20145243
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	1693186
GO:0008201	Function	Heparin binding	IDA	20145243
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	IMP	18441324
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IGI	8663044, 18187602
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18441324, 23469107
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IDA	20145243
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IGI	8663044, 18187602
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IMP	18441324
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IPI	10830168
GO:0009653	Process	Anatomical structure morphogenesis	TAS	1693186
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	23469107
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030324	Process	Lung development	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	20145243
GO:0030335	Process	Positive regulation of cell migration	IMP	18441324
GO:0031012	Component	Extracellular matrix	IEA
GO:0032148	Process	Activation of protein kinase B activity	IMP	18441324
GO:0034605	Process	Cellular response to heat	IDA	12746488
GO:0042060	Process	Wound healing	IDA	16756958
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	16756958
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0044548	Function	S100 protein binding	IPI	11432880
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	19229075
GO:0045766	Process	Positive regulation of angiogenesis	IDA	20145243
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19229075
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0051781	Process	Positive regulation of cell division	IDA	20145243
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060681	Process	Branch elongation involved in ureteric bud branching	IDA	11731227
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	18441324
GO:0072163	Process	Mesonephric epithelium development	IDA	11731227
GO:1901509	Process	Regulation of endothelial tube morphogenesis	IMP	23469107
GO:1902533	Process	Positive regulation of intracellular signal transduction	IDA	19229075
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IMP	23469107
GO:1905330	Process	Regulation of morphogenesis of an epithelium	IEA
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958
GO:2000544	Process	Regulation of endothelial cell chemotaxis to fibroblast growth factor	IEA

MIM	HGNC	e!Ensembl
131220	3665	ENSG00000113578

P05230

Protein name

Fibroblast growth factor 1 (FGF-1) (Acidic fibroblast growth factor) (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin-binding growth factor 1) (HBGF-1)

Protein function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of

PDB

1AXM , 1DJS , 1DZC , 1DZD , 1E0O , 1EVT , 1HKN , 1JQZ , 1JT3 , 1JT4 , 1JT5 , 1JT7 , 1JTC , 1JY0 , 1K5U , 1K5V , 1M16 , 1NZK , 1P63 , 1PZZ , 1Q03 , 1Q04 , 1RG8 , 1RML , 1RY7 , 1YTO , 1Z2V , 1Z4S , 2AFG , 2AQZ , 2AXM , 2ERM , 2HW9 , 2HWA , 2HWM , 2HZ9 , 2K43 , 2K4A , 2K8R , 2KI4 , 2KI6 , 2NTD , 2Q9X , 2RQ9 , 3B9U , 3BA4 , 3BA5 , 3BA7 , 3BAD , 3BAG , 3BAH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	25 → 148	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle. {ECO:0000269|PubMed:11964394, ECO:0000269|PubMed:7504343}.

Sequence

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Sequence length

155

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Hippo signaling pathway Regulation of actin cytoskeleton Pathways in cancer Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling Signaling by activated point mutants of FGFR1 Signaling by activated point mutants of FGFR3 FGFR4 ligand binding and activation FGFR1b ligand binding and activation FGFR3b ligand binding and activation FGFR3c ligand binding and activation FGFR1c ligand binding and activation FGFR2c ligand binding and activation FGFR2b ligand binding and activation FGFR3 mutant receptor activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer Phospholipase C-mediated cascade: FGFR1 Phospholipase C-mediated cascade; FGFR2 Phospholipase C-mediated cascade; FGFR3 Phospholipase C-mediated cascade; FGFR4 Downstream signaling of activated FGFR1 SHC-mediated cascade:FGFR1 PI-3K cascade:FGFR1 FRS-mediated FGFR1 signaling PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling PI-3K cascade:FGFR3 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Signaling by FGFR2 in disease Signaling by FGFR1 in disease RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Signaling by FGFR3 point mutants in cancer

FGF1 (fibroblast growth factor 1)