Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2237
Gene name Gene Name - the full gene name approved by the HGNC.
Flap structure-specific endonuclease 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FEN1
Synonyms (NCBI Gene) Gene synonyms aliases
FEN-1, MF1, RAD2
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene removes 5` overhanging flaps in DNA repair and processes the 5` ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excis
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000116 hsa-miR-24-3p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 19748357
MIRT000116 hsa-miR-24-3p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 19748357
MIRT016610 hsa-miR-193b-3p Proteomics 21512034
MIRT016610 hsa-miR-193b-3p Microarray 20304954
MIRT024421 hsa-miR-215-5p Microarray 19074876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IBA
GO:0000287 Function Magnesium ion binding IEA
GO:0000724 Process Double-strand break repair via homologous recombination TAS
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000781 Component Chromosome, telomeric region IDA 24270157
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600393 3650 ENSG00000168496
Protein
UniProt ID P39748
Protein name Flap endonuclease 1 (FEN-1) (EC 3.1.-.-) (DNase IV) (Flap structure-specific endonuclease 1) (Maturation factor 1) (MF1) (hFEN-1)
Protein function Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA
PDB 1U7B , 1UL1 , 3Q8K , 3Q8L , 3Q8M , 3UVU , 5E0V , 5FV7 , 5K97 , 5KSE , 5UM9 , 5ZOD , 5ZOE , 5ZOF , 5ZOG , 6TNZ , 7QO1 , 8YJH , 8YJL , 8YJQ , 8YJR , 8YJS , 8YJU , 8YJV , 8YJW , 8YJZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00752 XPG_N 1 107 XPG N-terminal domain Family
PF00867 XPG_I 146 233 XPG I-region Family
Sequence
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEA
EKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSD
YCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
Sequence length 380
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  DNA replication
Base excision repair
Non-homologous end-joining
  POLB-Dependent Long Patch Base Excision Repair
Early Phase of HIV Life Cycle
Removal of the Flap Intermediate from the C-strand
PCNA-Dependent Long Patch Base Excision Repair
HDR through MMEJ (alt-NHEJ)
Removal of the Flap Intermediate
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26431531, 27655641, 33508502, 39267056
Adenoma Associate 23951112
Adenomatous Polyposis Coli Associate 22787431, 24259968
Astrocytoma Associate 19596913
Autoimmune Diseases Associate 19010819
Bloom Syndrome Associate 16326861
Brain Neoplasms Associate 19596913
Breast Neoplasms Associate 19010819, 22787431, 24880630, 25111287, 25885449, 27801669, 31998443, 34117958
Carcinogenesis Associate 39766782
Carcinoma Ductal Breast Associate 34117958