Gene Gene information from NCBI Gene database.
Entrez ID 2237
Gene name Flap structure-specific endonuclease 1
Gene symbol FEN1
Synonyms (NCBI Gene)
FEN-1MF1RAD2
Chromosome 11
Chromosome location 11q12.2
Summary The protein encoded by this gene removes 5` overhanging flaps in DNA repair and processes the 5` ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excis
miRNA miRNA information provided by mirtarbase database.
263
miRTarBase ID miRNA Experiments Reference
MIRT000116 hsa-miR-24-3p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 19748357
MIRT000116 hsa-miR-24-3p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 19748357
MIRT016610 hsa-miR-193b-3p Proteomics 21512034
MIRT016610 hsa-miR-193b-3p Microarray 20304954
MIRT024421 hsa-miR-215-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
60
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IBA
GO:0000287 Function Magnesium ion binding IEA
GO:0000724 Process Double-strand break repair via homologous recombination TAS
GO:0000781 Component Chromosome, telomeric region HDA 19135898
GO:0000781 Component Chromosome, telomeric region IDA 24270157
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600393 3650 ENSG00000168496
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P39748
Protein name Flap endonuclease 1 (FEN-1) (EC 3.1.-.-) (DNase IV) (Flap structure-specific endonuclease 1) (Maturation factor 1) (MF1) (hFEN-1)
Protein function Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA
PDB 1U7B , 1UL1 , 3Q8K , 3Q8L , 3Q8M , 3UVU , 5E0V , 5FV7 , 5K97 , 5KSE , 5UM9 , 5ZOD , 5ZOE , 5ZOF , 5ZOG , 6TNZ , 7QO1 , 8YJH , 8YJL , 8YJQ , 8YJR , 8YJS , 8YJU , 8YJV , 8YJW , 8YJZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00752 XPG_N 1 107 XPG N-terminal domain Family
PF00867 XPG_I 146 233 XPG I-region Family
Sequence
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEA
EKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSD
YCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
Sequence length 380
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  DNA replication
Base excision repair
Non-homologous end-joining
  POLB-Dependent Long Patch Base Excision Repair
Early Phase of HIV Life Cycle
Removal of the Flap Intermediate from the C-strand
PCNA-Dependent Long Patch Base Excision Repair
HDR through MMEJ (alt-NHEJ)
Removal of the Flap Intermediate
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hereditary breast ovarian cancer syndrome Uncertain significance rs750703675 RCV001374574
Non-immune hydrops fetalis Uncertain significance rs764549465 RCV001844346
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26431531, 27655641, 33508502, 39267056
Adenoma Associate 23951112
Adenomatous Polyposis Coli Associate 22787431, 24259968
Astrocytoma Associate 19596913
Autoimmune Diseases Associate 19010819
Bloom Syndrome Associate 16326861
Brain Neoplasms Associate 19596913
Breast Neoplasms Associate 19010819, 22787431, 24880630, 25111287, 25885449, 27801669, 31998443, 34117958
Carcinogenesis Associate 39766782
Carcinoma Ductal Breast Associate 34117958