Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	222894
Gene name Gene Name - the full gene name approved by the HGNC.	Fer3 like bHLH transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FERD3L
Synonyms (NCBI Gene) Gene synonyms aliases	N-TWIST, NATO3, NTWIST, PTFB, bHLHa31
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p21.1

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments
MIRT994712	hsa-miR-329	CLIP-seq
MIRT994713	hsa-miR-362-3p	CLIP-seq
MIRT994714	hsa-miR-642b	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 31515488
GO:0005634	Component	Nucleus	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0032502	Process	Developmental process	IBA	21873635
GO:0033504	Process	Floor plate development	IEA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048468	Process	Cell development	IEA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
617578	16660	ENSG00000146618

Protein

UniProt ID

Q96RJ6

Protein name

Fer3-like protein (Basic helix-loop-helix protein N-twist) (Class A basic helix-loop-helix protein 31) (bHLHa31) (Nephew of atonal 3) (Neuronal twist)

Protein function

Transcription factor that binds to the E-box and functions as inhibitor of transcription. DNA binding requires dimerization with an E protein. Inhibits transcription activation by ASCL1/MASH1 by sequestering E proteins (By similarity). {ECO:0000

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	102 → 154	Helix-loop-helix DNA-binding domain	Domain

Sequence

MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEG
DPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEA
FDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG

Sequence length

166

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	Source
Unknown
Intracranial Aneurysm	Intracranial Aneurysm		GWAS
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis		GWAS
Borderline personality disorder	Borderline personality disorder		GWAS
Psoriasis	Psoriasis		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining
Triple Negative Breast Neoplasms	Associate	30786922

FERD3L (Fer3 like bHLH transcription factor)