FERD3L (Fer3 like bHLH transcription factor)

Gene

• Entrez ID: 222894
• Gene name: Fer3 like bHLH transcription factor
• Gene symbol: FERD3L
• Synonyms (NCBI Gene): N-TWIST, NATO3, NTWIST, PTFB, bHLHa31
• Chromosome: 7
• Chromosome location: 7p21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT994712	hsa-miR-329	CLIP-seq
MIRT994713	hsa-miR-362-3p	CLIP-seq
MIRT994714	hsa-miR-642b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 31515488, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0032502	Process	Developmental process	IBA
GO:0033504	Process	Floor plate development	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048468	Process	Cell development	IEA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:1904338	Process	Regulation of dopaminergic neuron differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 617578
• HGNC: 16660
• e!Ensembl: ENSG00000146618

Protein

• UniProt ID: Q96RJ6
• Protein name: Fer3-like protein (Basic helix-loop-helix protein N-twist) (Class A basic helix-loop-helix protein 31) (bHLHa31) (Nephew of atonal 3) (Neuronal twist)
• Protein function: Transcription factor that binds to the E-box and functions as inhibitor of transcription. DNA binding requires dimerization with an E protein. Inhibits transcription activation by ASCL1/MASH1 by sequestering E proteins (By similarity). {ECO:0000
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	102 → 154	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEG
  DPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRERKRMFNLNEA
  FDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG

• Sequence length: 166