NKAPL (NFKB activating protein like)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
222698
Gene name Gene Name - the full gene name approved by the HGNC.
NFKB activating protein like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NKAPL
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf194, bA424I5.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(55)
miRTarBase ID miRNA Experiments Reference
MIRT663507 hsa-miR-873-3p HITS-CLIP 23313552
MIRT684694 hsa-miR-6867-5p HITS-CLIP 23313552
MIRT663506 hsa-miR-3672 HITS-CLIP 23313552
MIRT663505 hsa-miR-6864-3p HITS-CLIP 23313552
MIRT663504 hsa-miR-6818-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0003682 Function Chromatin binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0007283 Process Spermatogenesis IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5M9Q1
Protein name NKAP-like protein
Protein function Transcriptional repressor of Notch-mediated signaling. Required for spermatogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15692 NKAP 109 → 204 Family
PF06047 Nkap_C 293 → 394 NF-kappa-B-activating protein C-terminal domain Domain
Sequence 
MPPVSRSSYSEDIVGSRRRRRSSSGSPPSPQSRCSSWDGCSRSHSRGREGLRPPWSELDV
GALYPFSRSGSRGRLPRFRNYAFASSWSTSYSGYRYHRHCYAEERQSAEDYEKEESHRQR
RLKERERIGELGAPEVWGPSPKFPQLDSDEHTPVEDEEEVTHQKSSSSDSNSEEHRKKKT
SRSRNKKKRKNKSSKRKHRKYSDSDSNSESDTNSDSDDDKKRVKAKKKKKKKKHKTKKKK
NKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTMDLIGPEAPIIHTSQDEKPLKYGHAL
LPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIGSFECSGYVMSGSRHRRMEAVRLRKENQI
YSADEKRALASFNQEERRKRESKILASFREMVHKKTKEKDDK
Sequence length 402
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 23223422
Neoplasms Associate 28427185
Stomach Neoplasms Associate 29923336