UNC5CL (unc-5 family C-terminal like)

Gene

• Entrez ID: 222643
• Gene name: Unc-5 family C-terminal like
• Gene symbol: UNC5CL
• Synonyms (NCBI Gene): MUXA, ZUD
• Chromosome: 6
• Chromosome location: 6p21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018350	hsa-miR-335-5p	Microarray	18185580
MIRT1475571	hsa-miR-1291	CLIP-seq
MIRT1475572	hsa-miR-3131	CLIP-seq
MIRT1475573	hsa-miR-3647-3p	CLIP-seq
MIRT1475574	hsa-miR-4767	CLIP-seq
MIRT1475575	hsa-miR-494	CLIP-seq
MIRT1475576	hsa-miR-552	CLIP-seq
MIRT1475577	hsa-miR-611	CLIP-seq
MIRT1475578	hsa-miR-764	CLIP-seq
MIRT1921021	hsa-miR-376a	CLIP-seq
MIRT1921022	hsa-miR-376b	CLIP-seq
MIRT1921021	hsa-miR-376a	CLIP-seq
MIRT1921022	hsa-miR-376b	CLIP-seq
MIRT1921021	hsa-miR-376a	CLIP-seq
MIRT1921022	hsa-miR-376b	CLIP-seq
MIRT2143331	hsa-miR-140-3p	CLIP-seq
MIRT2143332	hsa-miR-3136-5p	CLIP-seq
MIRT2143333	hsa-miR-4427	CLIP-seq
MIRT2143334	hsa-miR-4439	CLIP-seq
MIRT2143335	hsa-miR-4513	CLIP-seq
MIRT2143336	hsa-miR-4686	CLIP-seq
MIRT2143337	hsa-miR-4789-3p	CLIP-seq
MIRT2143338	hsa-miR-628-5p	CLIP-seq
MIRT2363579	hsa-miR-302a	CLIP-seq
MIRT2363580	hsa-miR-302b	CLIP-seq
MIRT2363581	hsa-miR-302c	CLIP-seq
MIRT2363582	hsa-miR-302d	CLIP-seq
MIRT2363583	hsa-miR-302e	CLIP-seq
MIRT1475573	hsa-miR-3647-3p	CLIP-seq
MIRT2363584	hsa-miR-372	CLIP-seq
MIRT2363585	hsa-miR-373	CLIP-seq
MIRT2143333	hsa-miR-4427	CLIP-seq
MIRT2143337	hsa-miR-4789-3p	CLIP-seq
MIRT2363586	hsa-miR-520a-3p	CLIP-seq
MIRT2363587	hsa-miR-520b	CLIP-seq
MIRT2363588	hsa-miR-520c-3p	CLIP-seq
MIRT2363589	hsa-miR-520d-3p	CLIP-seq
MIRT2363590	hsa-miR-520e	CLIP-seq
MIRT1475572	hsa-miR-3131	CLIP-seq
MIRT1475574	hsa-miR-4767	CLIP-seq
MIRT2462932	hsa-miR-485-5p	CLIP-seq
MIRT1475577	hsa-miR-611	CLIP-seq
MIRT1475572	hsa-miR-3131	CLIP-seq
MIRT1475574	hsa-miR-4767	CLIP-seq
MIRT2462932	hsa-miR-485-5p	CLIP-seq
MIRT1475577	hsa-miR-611	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005042	Function	Netrin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0007165	Process	Signal transduction	IEA
GO:0008233	Function	Peptidase activity	IDA	22158417
GO:0016020	Component	Membrane	IDA	22158417
GO:0016020	Component	Membrane	IEA
GO:0038007	Process	Netrin-activated signaling pathway	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	22158417
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	22158417

Other IDs

• MIM: 617464
• HGNC: 21203
• e!Ensembl: ENSG00000124602

Protein

• UniProt ID: Q8IV45
• Protein name: UNC5C-like protein (Protein unc-5 homolog C-like) (ZU5 and death domain-containing protein)
• Protein function: Inhibits NF-kappa-B-dependent transcription by impairing NF-kappa-B binding to its targets.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00791	ZU5	103 → 197	ZU5 domain	Family
  PF17217	UPA	243 → 372	UPA domain	Domain
  PF00531	Death	413 → 491	Death domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in pancreas, liver and kidney. {ECO:0000269|PubMed:14769797}.
• Sequence:

  MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHCPRRLLGACWTLNGQEEPVSQPTPQL
  ENEVSRQHLPATLPEMVAFYQELHTPTQGQTMVRQLMHKLLVFSAREVDHRGGCLMLQDT
  GISLLIPPGAVAVGRQERVSLILVWDLSDAPSLSQAQGLVSPVVACGPHGASFLKPCTLT
  FKHCAEQPSHARTYSSNTTLLDAKVWRPLGRPGAHASRDECRIHLSHFSLYTCVLEAPVG
  REARKWLQLAVFCSPLVPGQSHLQLRIYFLNNTPCALQWALTNEQPHGGRLRGPCQLFDF
  NGARGDQCLKLTYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKAADENEDCSAL
  TNEIIVTMHTFQDGLETKYMEILRFQASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLL
  EPNSITGNDWRRLASHLGLCGMKIRFLSCQRSPAAAILELFEEQNGSLQELHYLMTVMER
  LDCASAIQNYLSGTHGGSPGPERGGARDNQGLELDEKL

• Sequence length: 518

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Esophageal Squamous Cell Carcinoma	Associate	22865593	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26129866	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	26129866	★☆☆☆☆ Found in Text Mining only