FOXK1 (forkhead box K1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 221937
Gene name Forkhead box K1
Gene symbol FOXK1
Synonyms (NCBI Gene)
FOXK1L
Chromosome 7
Chromosome location 7p22.1
miRNA miRNA information provided by mirtarbase database.
2155
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2155)
miRTarBase ID miRNA Experiments Reference
MIRT020900 hsa-miR-155-5p Proteomics 18668040
MIRT021201 hsa-miR-186-5p Sequencing 20371350
MIRT032384 hsa-let-7b-5p Proteomics 18668040
MIRT046442 hsa-miR-15b-5p CLASH 23622248
MIRT045618 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
36
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (36)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 17670796, 25402684, 29861159
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
616302 23480 ENSG00000164916
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P85037
Protein name Forkhead box protein K1 (Myocyte nuclear factor) (MNF)
Protein function Transcriptional regulator involved in different processes such as glucose metabolism, aerobic glycolysis, muscle cell differentiation and autophagy (By similarity). Recognizes and binds the forkhead DNA sequence motif (5'-GTAAACA-3') and can bot
PDB 8BZM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00498 FHA 123 → 193 FHA domain Family
PF00250 Forkhead 304 → 390 Forkhead domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed both developing and adult tissues (PubMed:15289879). In adults, significant expression is seen in tumors of the brain, colon and lymph node (PubMed:15289879). {ECO:0000269|PubMed:15289879}.
Sequence 
MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPL
PPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQSPGPALARLEGREFEFLMRQ
PSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAP
ALQLPKQCTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSMVSP
VPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADTSGGDSP
KDESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLN
RYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPAS
PTHPGLMSPRSGGLQTPECLSREGSPIPHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVI
MAVPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYIL
TSQGAAGGSHDAAGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQTVASQMAPGVPGHT
VTILQPATPVTLGQHHLPVRAVTQNGKHAVPTNSLAGNAYALTSPLQLLATQASSSAPVV
VTRVCEVGPKEPAAAVAATATTTPATATTASASASSTGEPEVKRSRVEEPSGAVTTPAGV
IAAAGPQGPGTGE
Sequence length 733
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Polycomb repressive complex   UCH proteinases
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Colon adenocarcinoma Uncertain significance rs778526385 RCV005937489
Show/Hide Text Mining Associations (22)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 32807774
Autistic Disorder Associate 28171595
Breast Neoplasms Associate 31799667
Carcinoma Hepatocellular Associate 33880589, 36806218
Carcinoma Hepatocellular Stimulate 38302914
Carcinoma Non Small Cell Lung Associate 35166053
Colorectal Neoplasms Associate 28623323, 30562730, 35536149
Esophageal Squamous Cell Carcinoma Stimulate 37173384
Fibrosis Associate 38302914
Klatskin Tumor Associate 33300075