Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
221927
Gene name Gene Name - the full gene name approved by the HGNC.
BRCA1 associated ATM activator 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BRAT1
Synonyms (NCBI Gene) Gene synonyms aliases
BAAT1, C7orf27, NEDCAS, RMFSL
Disease Acronyms (UniProt) Disease acronyms from UniProt database
NEDCAS, RMFSL
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signall
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs61729932 G>A Conflicting-interpretations-of-pathogenicity Non coding transcript variant, 3 prime UTR variant, missense variant, coding sequence variant
rs61753094 G>A Uncertain-significance, conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, coding sequence variant
rs140833277 G>A Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant, genic upstream transcript variant, non coding transcript variant, 5 prime UTR variant
rs145833100 C>T Conflicting-interpretations-of-pathogenicity 3 prime UTR variant, non coding transcript variant, coding sequence variant, missense variant
rs147005619 T>A Likely-pathogenic Intron variant, genic upstream transcript variant, splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016937 hsa-miR-335-5p Microarray 18185580
MIRT051289 hsa-miR-16-5p CLASH 23622248
MIRT050026 hsa-miR-27a-3p CLASH 23622248
MIRT046452 hsa-miR-15b-5p CLASH 23622248
MIRT046230 hsa-miR-27b-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001934 Process Positive regulation of protein phosphorylation IBA 21873635
GO:0001934 Process Positive regulation of protein phosphorylation IMP 22977523
GO:0005515 Function Protein binding IPI 16452482, 22977523, 25631046, 25657994, 32296183, 32814053
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 16452482, 25631046
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614506 21701 ENSG00000106009
Protein
UniProt ID Q6PJG6
Protein name Integrator complex assembly factor BRAT1 (BRCA1-associated ATM activator 1) (BRCA1-associated protein required for ATM activation protein 1)
Protein function Component of a multiprotein complex required for the assembly of the RNA endonuclease module of the integrator complex (PubMed:39032489, PubMed:39032490). Associates with INTS9 and INTS11 in the cytoplasm and blocks the active site of INTS11 to
PDB 4IFI , 8R22 , 8R23 , 8R2D , 8UIB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02985 HEAT 501 531 HEAT repeat Repeat
PF02985 HEAT 546 576 HEAT repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:16452482}.
Sequence
MDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESSVVLLQEHPCLVELLS
HVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPGPLGRATWAVPTVR
SGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASAASQLLVHVLALSMRGGA
EGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLTTTFGRCQSPWTEALWVRL
SPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLWETVARALSCLGPTHMGPLAL
GILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSS
CAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLRLCDGSAAPASSVGGHLCGTLA
GCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLESPGSSPTVLKKAFQATLRWLLS
SPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQADFRCA
LLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQGLHAPTSPEHAEARQSLFLELLHIL
SVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEVRAQGLELALV
FLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGLFDFAFCALFDCDRPVAQKSC
DLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAMLRSLD
LEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY
Sequence length 821
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Dysautonomia Dysautonomia rs111033171, rs137853022, rs28939712, rs754348901, rs749052963, rs1057517169, rs1057516865, rs763445509, rs767527819, rs781333644, rs1239081703, rs1554696574, rs539544212, rs1201626345, rs774890086
View all (27 more)
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Microcephaly Microcephaly rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019
View all (280 more)
Unknown
Disease term Disease name Evidence References Source
Encephalopathy neonatal-onset encephalopathy with rigidity and seizures GenCC
Neurodevelopmental Disorder With Cerebellar Atrophy And With Or Without Seizures neurodevelopmental disorder with cerebellar atrophy and with or without seizures GenCC
Associations from Text Mining
Disease Name Relationship Type References
Apnea Associate 33040300
Apraxias Associate 28635423, 35360849
Ataxia Associate 35360849
Atrophy Associate 26947546
Bradycardia Associate 33040300
Brain Diseases Associate 26947546, 29997391, 30786674, 33040300, 36599696
Central Nervous System Diseases Associate 30786674
Cerebellar Ataxia Associate 28635423
Cerebellar Diseases Associate 28635423, 33040300, 35360849
Death Associate 26947546, 31868227, 35360849