Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	221914
Gene name Gene Name - the full gene name approved by the HGNC.	Glypican 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPC2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1

Show/Hide all(25)

miRTarBase ID	miRNA	Experiments
MIRT1028565	hsa-miR-1207-3p	CLIP-seq
MIRT1028566	hsa-miR-146b-3p	CLIP-seq
MIRT1028567	hsa-miR-205	CLIP-seq
MIRT1028568	hsa-miR-2355-5p	CLIP-seq
MIRT1028569	hsa-miR-3127-3p	CLIP-seq
MIRT1028570	hsa-miR-3144-3p	CLIP-seq
MIRT1028571	hsa-miR-3146	CLIP-seq
MIRT1028572	hsa-miR-3173-5p	CLIP-seq
MIRT1028573	hsa-miR-324-5p	CLIP-seq
MIRT1028574	hsa-miR-421	CLIP-seq
MIRT1028575	hsa-miR-4263	CLIP-seq
MIRT1028576	hsa-miR-4267	CLIP-seq
MIRT1028577	hsa-miR-4436b-3p	CLIP-seq
MIRT1028578	hsa-miR-4502	CLIP-seq
MIRT1028579	hsa-miR-4641	CLIP-seq
MIRT1028580	hsa-miR-4709-5p	CLIP-seq
MIRT1028581	hsa-miR-4721	CLIP-seq
MIRT1028582	hsa-miR-4724-3p	CLIP-seq
MIRT1028583	hsa-miR-4761-3p	CLIP-seq
MIRT1028584	hsa-miR-874	CLIP-seq
MIRT1028585	hsa-miR-875-5p	CLIP-seq
MIRT2005156	hsa-miR-4684-5p	CLIP-seq
MIRT1028568	hsa-miR-2355-5p	CLIP-seq
MIRT1028569	hsa-miR-3127-3p	CLIP-seq
MIRT2388609	hsa-miR-4431	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0005515	Function	Protein binding	IPI	29162697
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006024	Process	Glycosaminoglycan biosynthetic process	TAS
GO:0006027	Process	Glycosaminoglycan catabolic process	TAS
GO:0007224	Process	Smoothened signaling pathway	IBA	21873635
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IBA	21873635
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016477	Process	Cell migration	IBA	21873635
GO:0030182	Process	Neuron differentiation	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045202	Component	Synapse	IBA	21873635
GO:0046658	Component	Anchored component of plasma membrane	IEA
GO:0062023	Component	Collagen-containing extracellular matrix	IEA
GO:1905475	Process	Regulation of protein localization to membrane	IBA	21873635

MIM	HGNC	e!Ensembl
618446	4450	ENSG00000213420

Protein

UniProt ID

Q8N158

Protein name

Glypican-2 [Cleaved into: Secreted glypican-2]

Protein function

Cell surface proteoglycan that bears heparan sulfate. May fulfill a function related to the motile behaviors of developing neurons (By similarity).

PDB

6WJL , 7T62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01153	Glypican	11 → 566	Glypican	Family

Sequence

MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLR
VCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQH
SLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHP
QYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSE
ALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGL
LILADKLQGPFSFELTAESIGVKISEGLMYLQENSAKVSAQVFQECGPPDPVPARNRRAP
PPREEAGRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDSRMAA
DASLEAAPCWTGAGRGRYLPPVVGGSPAEQVNNPELKVDASGPDVPTRRRRLQLRAATAR
MKTAALGHDLDGQDADEDASGSGGGQQYADDWMAGAVAPPARPPRPPYPPRRDGSGGKGG
GGSARYNQGRSRSGGASIGFHTQTILILSLSALALLGPR

Sequence length

579

Interactions

View interactions

	Reactome
			A tetrasaccharide linker sequence is required for GAG synthesis HS-GAG biosynthesis HS-GAG degradation Defective B4GALT7 causes EDS, progeroid type Defective B3GAT3 causes JDSSDHD Defective EXT2 causes exostoses 2 Defective EXT1 causes exostoses 1, TRPS2 and CHDS Defective B3GALT6 causes EDSP2 and SEMDJL1 Retinoid metabolism and transport

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Brain Neoplasms	Associate	35345673, 36167467
Carcinoma Hepatocellular	Associate	33902495
Chemical and Drug Induced Liver Injury	Associate	33902495
Esophageal Neoplasms	Associate	40234833
Glioblastoma	Stimulate	37609818
Glioma	Associate	36167467
Glioma	Stimulate	37609818
Medulloblastoma	Associate	36167467
Neoplasms	Associate	35345673, 35852863, 36944188, 40234833
Neoplasms Germ Cell and Embryonal	Associate	36167467
Neuroblastoma	Associate	34465595, 35345673, 35852863, 36167467
Neurotoxicity Syndromes	Associate	36167467
Pancreatic Neoplasms	Associate	35345673
Prostatic Neoplasms	Associate	30286759
Small Cell Lung Carcinoma	Associate	35345673
Squamous Cell Carcinoma of Head and Neck	Associate	25935541
Thymoma	Associate	35345673
Urinary Bladder Neoplasms	Associate	34315402

GPC2 (glypican 2)