Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	221687
Gene name Gene Name - the full gene name approved by the HGNC.	Ring finger protein 182
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RNF182
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p23

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022017	hsa-miR-128-3p	Sequencing	20371350
MIRT028709	hsa-miR-27a-3p	Sequencing	20371350
MIRT048330	hsa-miR-106a-5p	CLASH	23622248
MIRT1311502	hsa-miR-1264	CLIP-seq
MIRT1311503	hsa-miR-371-5p	CLIP-seq
MIRT1311504	hsa-miR-377	CLIP-seq
MIRT1311505	hsa-miR-431	CLIP-seq
MIRT1311506	hsa-miR-888	CLIP-seq
MIRT1311507	hsa-miR-4299	CLIP-seq
MIRT1311508	hsa-miR-4456	CLIP-seq
MIRT1311509	hsa-miR-4709-3p	CLIP-seq
MIRT1311510	hsa-miR-485-3p	CLIP-seq
MIRT1311511	hsa-miR-520d-5p	CLIP-seq
MIRT1311512	hsa-miR-524-5p	CLIP-seq
MIRT1311513	hsa-miR-548q	CLIP-seq
MIRT2092524	hsa-miR-136	CLIP-seq
MIRT2092525	hsa-miR-3158-3p	CLIP-seq
MIRT2092526	hsa-miR-4330	CLIP-seq
MIRT2092527	hsa-miR-4432	CLIP-seq
MIRT2092528	hsa-miR-4499	CLIP-seq
MIRT2092529	hsa-miR-4659a-3p	CLIP-seq
MIRT2092530	hsa-miR-4659b-3p	CLIP-seq
MIRT2092531	hsa-miR-499-5p	CLIP-seq
MIRT2092532	hsa-miR-942	CLIP-seq
MIRT2458431	hsa-miR-3065-5p	CLIP-seq
MIRT1311504	hsa-miR-377	CLIP-seq
MIRT2689846	hsa-miR-1183	CLIP-seq
MIRT2689847	hsa-miR-1208	CLIP-seq
MIRT2689848	hsa-miR-3064-3p	CLIP-seq
MIRT2689849	hsa-miR-34c-3p	CLIP-seq
MIRT2689850	hsa-miR-3919	CLIP-seq
MIRT2689851	hsa-miR-4528	CLIP-seq
MIRT2092529	hsa-miR-4659a-3p	CLIP-seq
MIRT2092530	hsa-miR-4659b-3p	CLIP-seq
MIRT2689852	hsa-miR-4731-3p	CLIP-seq
MIRT2689853	hsa-miR-4778-3p	CLIP-seq
MIRT2689854	hsa-miR-4789-5p	CLIP-seq
MIRT2689855	hsa-miR-4797-5p	CLIP-seq
MIRT2689856	hsa-miR-4801	CLIP-seq
MIRT2689857	hsa-miR-548p	CLIP-seq
MIRT2689858	hsa-miR-602	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18298843
GO:0005515	Function	Protein binding	IPI	18298843, 19690564, 25260751, 32296183
GO:0005737	Component	Cytoplasm	IDA	18298843
GO:0016021	Component	Integral component of membrane	IEA
GO:0016567	Process	Protein ubiquitination	IDA	18298843
GO:0016567	Process	Protein ubiquitination	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
621026	28522	ENSG00000180537

Protein

UniProt ID

Q8N6D2

Protein name

E3 ubiquitin-protein ligase RNF182 (EC 2.3.2.27) (RING finger protein 182) (RING-type E3 ubiquitin transferase RNF182)

Protein function

E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C and targets it to degradation via the ubiquitin-proteasome pathway (PubMed:18298843). Also plays a role in the inhibition of TLR-triggered innate immune response by mediatin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13639	zf-RING_2	18 → 68	Ring finger domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in neuronal cells subjected to cell death-inducing injuries, such as oxygen and glucose deprivation (at protein level). Could be up-regulated in Alzheimer disease brains (PubMed:18298843). Highly expressed in innate immune

Sequence

MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQG
VIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVS
PSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQT
SIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFL
DCMAPPS

Sequence length

247

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	18507500
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	18507500
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	18507500
Colorectal neoplasms	Colorectal Neoplasms	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	18507500
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	18507500

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Rheumatoid arthritis	Rheumatoid arthritis		GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining
Idiopathic Pulmonary Fibrosis	Associate	37783761

RNF182 (ring finger protein 182)