Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	221687
Gene name Gene Name - the full gene name approved by the HGNC.	Ring finger protein 182
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RNF182
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p23

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022017	hsa-miR-128-3p	Sequencing	20371350
MIRT028709	hsa-miR-27a-3p	Sequencing	20371350
MIRT048330	hsa-miR-106a-5p	CLASH	23622248
MIRT1311502	hsa-miR-1264	CLIP-seq
MIRT1311503	hsa-miR-371-5p	CLIP-seq
MIRT1311504	hsa-miR-377	CLIP-seq
MIRT1311505	hsa-miR-431	CLIP-seq
MIRT1311506	hsa-miR-888	CLIP-seq
MIRT1311507	hsa-miR-4299	CLIP-seq
MIRT1311508	hsa-miR-4456	CLIP-seq
MIRT1311509	hsa-miR-4709-3p	CLIP-seq
MIRT1311510	hsa-miR-485-3p	CLIP-seq
MIRT1311511	hsa-miR-520d-5p	CLIP-seq
MIRT1311512	hsa-miR-524-5p	CLIP-seq
MIRT1311513	hsa-miR-548q	CLIP-seq
MIRT2092524	hsa-miR-136	CLIP-seq
MIRT2092525	hsa-miR-3158-3p	CLIP-seq
MIRT2092526	hsa-miR-4330	CLIP-seq
MIRT2092527	hsa-miR-4432	CLIP-seq
MIRT2092528	hsa-miR-4499	CLIP-seq
MIRT2092529	hsa-miR-4659a-3p	CLIP-seq
MIRT2092530	hsa-miR-4659b-3p	CLIP-seq
MIRT2092531	hsa-miR-499-5p	CLIP-seq
MIRT2092532	hsa-miR-942	CLIP-seq
MIRT2458431	hsa-miR-3065-5p	CLIP-seq
MIRT1311504	hsa-miR-377	CLIP-seq
MIRT2689846	hsa-miR-1183	CLIP-seq
MIRT2689847	hsa-miR-1208	CLIP-seq
MIRT2689848	hsa-miR-3064-3p	CLIP-seq
MIRT2689849	hsa-miR-34c-3p	CLIP-seq
MIRT2689850	hsa-miR-3919	CLIP-seq
MIRT2689851	hsa-miR-4528	CLIP-seq
MIRT2092529	hsa-miR-4659a-3p	CLIP-seq
MIRT2092530	hsa-miR-4659b-3p	CLIP-seq
MIRT2689852	hsa-miR-4731-3p	CLIP-seq
MIRT2689853	hsa-miR-4778-3p	CLIP-seq
MIRT2689854	hsa-miR-4789-5p	CLIP-seq
MIRT2689855	hsa-miR-4797-5p	CLIP-seq
MIRT2689856	hsa-miR-4801	CLIP-seq
MIRT2689857	hsa-miR-548p	CLIP-seq
MIRT2689858	hsa-miR-602	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	18298843
GO:0005515	Function	Protein binding	IPI	18298843, 19690564, 25260751, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18298843
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	18298843
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
621026	28522	ENSG00000180537

Protein

UniProt ID

Q8N6D2

Protein name

E3 ubiquitin-protein ligase RNF182 (EC 2.3.2.27) (RING finger protein 182) (RING-type E3 ubiquitin transferase RNF182)

Protein function

E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C and targets it to degradation via the ubiquitin-proteasome pathway (PubMed:18298843). Also plays a role in the inhibition of TLR-triggered innate immune response by mediatin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13639	zf-RING_2	18 → 68	Ring finger domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in neuronal cells subjected to cell death-inducing injuries, such as oxygen and glucose deprivation (at protein level). Could be up-regulated in Alzheimer disease brains (PubMed:18298843). Highly expressed in innate immune

Sequence

MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQG
VIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVS
PSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQT
SIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFL
DCMAPPS

Sequence length

247

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer and/or colorectal cancer	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Idiopathic Pulmonary Fibrosis	Associate	37783761

RNF182 (ring finger protein 182)