Gene Gene information from NCBI Gene database.
Entrez ID 221687
Gene name Ring finger protein 182
Gene symbol RNF182
Synonyms (NCBI Gene)
-
Chromosome 6
Chromosome location 6p23
miRNA miRNA information provided by mirtarbase database.
41
miRTarBase ID miRNA Experiments Reference
MIRT022017 hsa-miR-128-3p Sequencing 20371350
MIRT028709 hsa-miR-27a-3p Sequencing 20371350
MIRT048330 hsa-miR-106a-5p CLASH 23622248
MIRT1311502 hsa-miR-1264 CLIP-seq
MIRT1311503 hsa-miR-371-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IBA
GO:0004842 Function Ubiquitin-protein transferase activity IDA 18298843
GO:0005515 Function Protein binding IPI 18298843, 19690564, 25260751, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 18298843
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
621026 28522 ENSG00000180537
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N6D2
Protein name E3 ubiquitin-protein ligase RNF182 (EC 2.3.2.27) (RING finger protein 182) (RING-type E3 ubiquitin transferase RNF182)
Protein function E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C and targets it to degradation via the ubiquitin-proteasome pathway (PubMed:18298843). Also plays a role in the inhibition of TLR-triggered innate immune response by mediatin
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13639 zf-RING_2 18 68 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Up-regulated in neuronal cells subjected to cell death-inducing injuries, such as oxygen and glucose deprivation (at protein level). Could be up-regulated in Alzheimer disease brains (PubMed:18298843). Highly expressed in innate immune
Sequence
MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQG
VIVCPFCR
FETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVS
PSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQT
SIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFL
DCMAPPS
Sequence length 247
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation