Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
221496
Gene name Gene Name - the full gene name approved by the HGNC.
LEM domain nuclear envelope protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LEMD2
Synonyms (NCBI Gene) Gene synonyms aliases
CTRCT42, LEM2, MARUPS, NET25, dJ482C21.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a LEM domain-containing transmembrane protein of the inner nuclear membrane. The protein is involved in nuclear structure organization and plays a role in cell signaling and differentiation. Mutations in this gene result in Cataract 46,
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs878852983 A>C,T Pathogenic 5 prime UTR variant, missense variant, coding sequence variant, genic upstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050421 hsa-miR-23a-3p CLASH 23622248
MIRT648637 hsa-miR-8060 HITS-CLIP 23824327
MIRT648636 hsa-miR-5088-3p HITS-CLIP 23824327
MIRT648635 hsa-miR-4769-3p HITS-CLIP 23824327
MIRT648634 hsa-miR-6817-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 28242692
GO:0005515 Function Protein binding IPI 28242692, 28514442, 33961781
GO:0005634 Component Nucleus IEA
GO:0005635 Component Nuclear envelope IDA 28242692
GO:0005635 Component Nuclear envelope IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616312 21244 ENSG00000161904
Protein
UniProt ID Q8NC56
Protein name LEM domain-containing protein 2 (hLEM2)
Protein function Nuclear lamina-associated inner nuclear membrane protein that is involved in nuclear structure organization, maintenance of nuclear envelope (NE) integrity and NE reformation after mitosis (PubMed:16339967, PubMed:17097643, PubMed:28242692, PubM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03020 LEM 1 39 LEM domain Domain
PF09402 MSC 241 495 Man1-Src1p-C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed, including bone marrow, brain, kidney, colon, skeletal muscle, thymus, testis and uterus. {ECO:0000269|PubMed:16339967}.
Sequence
MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEERLREEARPRGEE
RLREEARLREDAPLRARPAAASPRAEPWLSQPASGSAYATPGAYGDIRPSAASWVGSRGL
AYPARPAQLRRRASVRGSSEEDEDARTPDRATQGPGLAARRWWAASPAPARLPSSLLGPD
PRPGLRATRAGPAGAARARPEVGRRLERWLSRLLLWASLGLLLVFLGILWVKMGKPSAPQ
EAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCI
PVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAH
PRMGVGCRLSRALLTAVTNVLIFFWCLAFLWGLLILLKYRWRKLEEEEQAMYEMVKKIID
VVQDHYVDWEQDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH
RVAGEDMLVWRWTKP
SSFSDSER
Sequence length 503
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nuclear Envelope Breakdown
Initiation of Nuclear Envelope (NE) Reformation
Depolymerisation of the Nuclear Lamina
Sealing of the nuclear envelope (NE) by ESCRT-III
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cataract Cataract 46 juvenile-onset rs878852983 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma in any disease N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 35650630
Alzheimer's disease without Neurofibrillary tangles Inhibit 36001963
Cataract Associate 36161833
Cataract Nuclear Progressive Associate 30905398
Developmental Disabilities Associate 38098057
Genetic Diseases Inborn Associate 30905398
Growth Disorders Associate 30905398
Jaw Diseases Associate 30905398
Neoplasms Associate 35650630
Progeria Associate 30905398