Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
221421
Gene name Gene Name - the full gene name approved by the HGNC.
Radial spoke head component 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RSPH9
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf206, CILD12, MRPS18AL1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein thought to be a component of the radial spoke head in motile cilia and flagella. Mutations in this gene are associated with primary ciliary dyskinesia 12. Alternative splicing results in multiple transcript variants.[provided b
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs376496894 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs397515488 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs775136764 T>A,C,G Likely-pathogenic Intron variant
rs1057520543 T>G Pathogenic Intron variant, non coding transcript variant, coding sequence variant, stop gained
rs1233811324 C>A Pathogenic Non coding transcript variant, stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017711 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001534 Component Radial spoke IEA
GO:0001535 Component Radial spoke head IEA
GO:0001535 Component Radial spoke head ISS
GO:0003341 Process Cilium movement IEA
GO:0003341 Process Cilium movement IMP 19200523
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612648 21057 ENSG00000172426
Protein
UniProt ID Q9H1X1
Protein name Radial spoke head protein 9 homolog
Protein function Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia (PubMed:19200523). Essential for both the radial spoke head assembly and the central pair microtubule stability in ependymal moti
PDB 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04712 Radial_spoke 191 276 Radial spokehead-like protein Family
Sequence
MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIA
QGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVN
EGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSE
AKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLR
SLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML
Sequence length 276
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ciliary dyskinesia Primary ciliary dyskinesia 12, primary ciliary dyskinesia rs397515340, rs397515488, rs775136764, rs376496894, rs1233811324, rs1436804091, rs1582373132, rs1554149875 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bronchiectasis Associate 22384920
Carcinoma Non Small Cell Lung Associate 31886214
Ciliary Motility Disorders Associate 20070851, 22384920, 25789548, 33577779
Cystic Fibrosis Associate 22384920
Immotile cilia syndrome due to defective radial spokes Associate 25789548
Nasopharyngeal Carcinoma Associate 30935420