Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	221395
Gene name	Adhesion G protein-coupled receptor F5
Gene symbol	ADGRF5
Synonyms (NCBI Gene)	GPR116KPG_001
Chromosome	6
Chromosome location	6p12.3

Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT741988	hsa-miR-454-5p	HITS-CLIP	23824327
MIRT741989	hsa-miR-5193	HITS-CLIP	23824327
MIRT741990	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT741991	hsa-miR-1252-5p	HITS-CLIP	23824327
MIRT741992	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT741993	hsa-miR-6883-3p	HITS-CLIP	23824327
MIRT741994	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT741995	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT741996	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT741997	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT741998	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT741999	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT742000	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT742001	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT742002	hsa-miR-30e-3p	HITS-CLIP	23824327

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003094	Process	Glomerular filtration	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	15203201
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0006112	Process	Energy reserve metabolic process	IBA
GO:0006112	Process	Energy reserve metabolic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15203201
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0009986	Component	Cell surface	IDA	23684610
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	15203201
GO:0019216	Process	Regulation of lipid metabolic process	IBA
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	23684610
GO:0042116	Process	Macrophage activation	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0043031	Process	Negative regulation of macrophage activation	IEA
GO:0043129	Process	Surfactant homeostasis	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0045444	Process	Fat cell differentiation	IBA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0048821	Process	Erythrocyte development	IEA
GO:0061626	Process	Pharyngeal arch artery morphogenesis	IEA
GO:0071073	Process	Positive regulation of phospholipid biosynthetic process	IEA

MIM	HGNC	e!Ensembl
620874	19030	ENSG00000069122

Q8IZF2

Protein name

Adhesion G protein-coupled receptor F5 (G-protein coupled receptor 116)

Protein function

Adhesion G protein-coupled receptor (PubMed:28570277). In alveolar type II (ATII or AT2) cells, required for normal lung surfactant homeostasis (PubMed:28570277). Modulation of both surfactant secretion and uptake by ATII cells is mediated by th

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01390	SEA	168 → 272	SEA domain	Family
PF13927	Ig_3	275 → 353		Domain
PF01825	GPS	952 → 996	GPCR proteolysis site, GPS, motif	Motif
PF00002	7tm_2	1010 → 1262	7 transmembrane receptor (Secretin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung endothelial cells and in alveolar type II (ATII) cells (at protein level) (PubMed:23684610, PubMed:28570277). Expressed high levels in subcutaneous adipose tissue in lean individuals and at lower levels in visceral fa

Sequence

MKSPRRTTLCLMFIVIYSSKAALNWNYESTIHPLSLHEHEPAGEEALRQKRAVATKSPTA
EEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWC
SCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNV
GFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPS
LELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSS
NVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYVCKLILDIFEYE
CKKKIDVMPIQILANEEMKVMCDNNPVSLNCCSQGNVNWSKVEWKQEGKINIPGTPETDI
DSSCSRYTLKADGTQCPSGSSGTTVIYTCEFISAYGARGSANIKVTFISVANLTITPDPI
SVSEGQNFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYLDGAESVLTVKTSTREWN
GTYHCIFRYKNSYSIATKDVIVHPLPLKLNIMVDPLEATVSCSGSHHIKCCIEEDGDYKV
TFHTGSSSLPAAKEVNKKQVCYKHNFNASSVSWCSKTVDVCCHFTNAANNSVWSPSMKLN
LVPGENITCQDPVIGVGEPGKVIQKLCRFSNVPSSPESPIGGTITYKCVGSQWEEKRNDC
ISAPINSLLQMAKALIKSPSQDEMLPTYLKDLSISIDKAEHEISSSPGSLGAIINILDLL
STVPTQVNSEMMTHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQALQSGD
SPPLSFSQTNVQMSSMVIKSSHPETYQQRFVFPYFDLWGNVVIDKSYLENLQSDSSIVTM
AFPTLQAILAQDIQENNFAESLVMTTTVSHNTTMPFRISMTFKNNSPSGGETKCVFWNFR
LANNTGGWDSSGCYVEEGDGDNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGV
GFSILSLAACLVVEAVVWKSVTKNRTSYMRHTCIVNIAASLLVANTWFIVVAAIQDNRYI
LCKTACVAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILHETSRSTQKAIAFCLGYGCPL
AISVITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVNITITIVVITKILRP
SIGDKPCKQEKSSLFQISKSIGVLTPLLGLTWGFGLTTVFPGTNLVFHIIFAILNVFQGL
FILLFGCLWDLKVQEALLNKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKT
GTYNVSTPEATSSSLENSSSASSLLN

Sequence length

1346

Interactions

View interactions

	Reactome
			Surfactant metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Associate	40033250	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	28624786, 35049225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	24376576, 35049225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	28624786, 31364112	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	36497132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	34042246	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Associate	40406128	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	35049225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	34042246	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	28624786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	28624786, 32047233, 36497132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	35049225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Associate	30569177	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	35049225	★★★★★ ★☆☆☆☆ Found in Text Mining only

ADGRF5 (adhesion G protein-coupled receptor F5)