FCGR2B (Fc gamma receptor IIb)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 2213
Gene name Fc gamma receptor IIb
Gene symbol FCGR2B
Synonyms (NCBI Gene)
CD32CD32BFCG2FCGR2FCGR2CFcGRIIBFcRII-cFcgammaRIIbIGFR2
Chromosome 1
Chromosome location 1q23.3
Summary The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in
SNPs SNP information provided by dbSNP.
2
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
SNP ID Visualize variation Clinical significance Consequence
rs1050501 T>A,C Risk-factor, protective Genic downstream transcript variant, downstream transcript variant, coding sequence variant, missense variant
rs3219018 G>C Risk-factor Upstream transcript variant, intron variant, genic upstream transcript variant
miRNA miRNA information provided by mirtarbase database.
29
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (29)
miRTarBase ID miRNA Experiments Reference
MIRT438477 hsa-miR-18a-5p qRT-PCRWestern blot 24169826
MIRT438477 hsa-miR-18a-5p qRT-PCRWestern blot 24169826
MIRT993861 hsa-miR-1183 CLIP-seq
MIRT993862 hsa-miR-194 CLIP-seq
MIRT993863 hsa-miR-4423-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
GATA4 Unknown 15153544
YY1 Unknown 15153544
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
68
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (68)
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding IPI 23921129
GO:0001540 Function Amyloid-beta binding TAS 26871627
GO:0001788 Process Antibody-dependent cellular cytotoxicity IBA
GO:0001811 Process Negative regulation of type I hypersensitivity ISS 26683154
GO:0001814 Process Negative regulation of antibody-dependent cellular cytotoxicity TAS 26683154
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604590 3618 ENSG00000072694
Protein Protein information from UniProt database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P31994
Protein name Low affinity immunoglobulin gamma Fc region receptor II-b (IgG Fc receptor II-b) (CDw32) (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b) (CD antigen CD32)
Protein function Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-ce
PDB 2FCB , 3WJJ , 5OCC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 49 → 128 Immunoglobulin domain Domain
PF13895 Ig_2 132 → 214 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cel
Sequence 
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI
Sequence length 310
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Virion - Ebolavirus, Lyssavirus and Morbillivirus
Phagosome
Osteoclast differentiation
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Measles 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Malaria, resistance to protective; risk factor rs1050501 RCV000005801
Systemic lupus erythematosus, susceptibility to risk factor; protective rs3219018, rs1050501 RCV000005799
RCV000005800
Show/Hide Text Mining Associations (70)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34602489
Anemia Hemolytic Autoimmune Associate 29692344
Arthritis Associate 21911970
Arthritis Psoriatic Associate 17521421
Arthritis Rheumatoid Associate 15547078, 15593228, 17133580, 17521421, 18240208, 18633424, 20398308, 25340460, 27140173, 30963994, 34858391, 37108786
Arthritis Rheumatoid Inhibit 20735866, 20850384
Asthma Associate 24586589
Atrial Fibrillation Inhibit 37581400
Atrophy Associate 35755170
Autoimmune Diseases Associate 12115230, 15703291, 19261857, 20385827, 20398308, 29692344