FCGR2B (Fc gamma receptor IIb)

Gene
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2213
Gene name Gene Name - the full gene name approved by the HGNC.
Fc gamma receptor IIb
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCGR2B
Synonyms (NCBI Gene) Gene synonyms aliases
CD32, CD32B, FCG2, FCGR2, FCGR2C, FcGRIIB, FcRII-c, FcgammaRIIb, IGFR2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
SNP ID Visualize variation Clinical significance Consequence
rs1050501 T>A,C Risk-factor, protective Genic downstream transcript variant, downstream transcript variant, coding sequence variant, missense variant
rs3219018 G>C Risk-factor Upstream transcript variant, intron variant, genic upstream transcript variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(29)
miRTarBase ID miRNA Experiments Reference
MIRT438477 hsa-miR-18a-5p qRT-PCR, Western blot 24169826
MIRT438477 hsa-miR-18a-5p qRT-PCR, Western blot 24169826
MIRT993861 hsa-miR-1183 CLIP-seq
MIRT993862 hsa-miR-194 CLIP-seq
MIRT993863 hsa-miR-4423-3p CLIP-seq
Transcription factors
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
GATA4 Unknown 15153544
YY1 Unknown 15153544
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(68)
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding IPI 23921129
GO:0001540 Function Amyloid-beta binding TAS 26871627
GO:0001788 Process Antibody-dependent cellular cytotoxicity IBA
GO:0001811 Process Negative regulation of type I hypersensitivity ISS 26683154
GO:0001814 Process Negative regulation of antibody-dependent cellular cytotoxicity TAS 26683154
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604590 3618 ENSG00000072694
Protein
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P31994
Protein name Low affinity immunoglobulin gamma Fc region receptor II-b (IgG Fc receptor II-b) (CDw32) (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b) (CD antigen CD32)
Protein function Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-ce
PDB 2FCB , 3WJJ , 5OCC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 49 → 128 Immunoglobulin domain Domain
PF13895 Ig_2 132 → 214 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cel
Sequence 
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI
Sequence length 310
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Virion - Ebolavirus, Lyssavirus and Morbillivirus
Phagosome
Osteoclast differentiation
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Measles 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus, susceptibility to, Systemic lupus erythematosus N/A N/A ClinVar, GWAS
Show/Hide Text Mining Associations (70)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34602489
Anemia Hemolytic Autoimmune Associate 29692344
Arthritis Associate 21911970
Arthritis Psoriatic Associate 17521421
Arthritis Rheumatoid Associate 15547078, 15593228, 17133580, 17521421, 18240208, 18633424, 20398308, 25340460, 27140173, 30963994, 34858391, 37108786
Arthritis Rheumatoid Inhibit 20735866, 20850384
Asthma Associate 24586589
Atrial Fibrillation Inhibit 37581400
Atrophy Associate 35755170
Autoimmune Diseases Associate 12115230, 15703291, 19261857, 20385827, 20398308, 29692344