Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2213
Gene name Gene Name - the full gene name approved by the HGNC.	Fc gamma receptor IIb
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FCGR2B
Synonyms (NCBI Gene) Gene synonyms aliases	CD32, CD32B, FCG2, FCGR2, FCGR2C, FcGRIIB, FcRII-c, FcgammaRIIb, IGFR2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1050501	T>A,C	Risk-factor, protective	Genic downstream transcript variant, downstream transcript variant, coding sequence variant, missense variant
rs3219018	G>C	Risk-factor	Upstream transcript variant, intron variant, genic upstream transcript variant

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438477	hsa-miR-18a-5p	qRT-PCR, Western blot	24169826
MIRT438477	hsa-miR-18a-5p	qRT-PCR, Western blot	24169826
MIRT993861	hsa-miR-1183	CLIP-seq
MIRT993862	hsa-miR-194	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq
MIRT993864	hsa-miR-4427	CLIP-seq
MIRT993865	hsa-miR-4724-5p	CLIP-seq
MIRT993866	hsa-miR-103a	CLIP-seq
MIRT993867	hsa-miR-107	CLIP-seq
MIRT993868	hsa-miR-1184	CLIP-seq
MIRT993869	hsa-miR-147	CLIP-seq
MIRT993862	hsa-miR-194	CLIP-seq
MIRT993870	hsa-miR-219-5p	CLIP-seq
MIRT993871	hsa-miR-339-5p	CLIP-seq
MIRT993872	hsa-miR-4287	CLIP-seq
MIRT993873	hsa-miR-4418	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq
MIRT993864	hsa-miR-4427	CLIP-seq
MIRT993874	hsa-miR-4445	CLIP-seq
MIRT993875	hsa-miR-4469	CLIP-seq
MIRT993876	hsa-miR-4666-5p	CLIP-seq
MIRT993877	hsa-miR-4685-3p	CLIP-seq
MIRT993865	hsa-miR-4724-5p	CLIP-seq
MIRT993878	hsa-miR-4742-5p	CLIP-seq
MIRT993879	hsa-miR-4782-3p	CLIP-seq
MIRT993880	hsa-miR-508-3p	CLIP-seq
MIRT993881	hsa-miR-509-3-5p	CLIP-seq
MIRT993882	hsa-miR-509-5p	CLIP-seq
MIRT993863	hsa-miR-4423-3p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
GATA4	Unknown	15153544
YY1	Unknown	15153544

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IPI	23921129
GO:0001540	Function	Amyloid-beta binding	TAS	26871627
GO:0001811	Process	Negative regulation of type I hypersensitivity	ISS	26683154
GO:0001814	Process	Negative regulation of antibody-dependent cellular cytotoxicity	TAS	26683154
GO:0001818	Process	Negative regulation of cytokine production	TAS	26683154
GO:0002266	Process	Follicular dendritic cell activation	TAS	26683154
GO:0002313	Process	Mature B cell differentiation involved in immune response	TAS	26683154
GO:0002316	Process	Follicular B cell differentiation	TAS	26683154
GO:0002436	Process	Immune complex clearance by monocytes and macrophages	TAS	26683154
GO:0002605	Process	Negative regulation of dendritic cell antigen processing and presentation	TAS	26683154
GO:0002622	Process	Regulation of B cell antigen processing and presentation	TAS	26683154
GO:0002638	Process	Negative regulation of immunoglobulin production	ISS	26683154
GO:0002819	Process	Regulation of adaptive immune response	TAS	26683154
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	ISS	26683154
GO:0002922	Process	Positive regulation of humoral immune response	TAS	26683154
GO:0002924	Process	Negative regulation of humoral immune response mediated by circulating immunoglobulin	ISS	26683154
GO:0004888	Function	Transmembrane signaling receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8577729, 9148918, 9603468, 10382761, 11567028, 17474147, 24642916, 32814053
GO:0005886	Component	Plasma membrane	IDA	2142460
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	23921129
GO:0006898	Process	Receptor-mediated endocytosis	IDA	2142460
GO:0006911	Process	Phagocytosis, engulfment	ISS	26683154
GO:0006952	Process	Defense response	ISS	26683154
GO:0006954	Process	Inflammatory response	TAS	26683154
GO:0006955	Process	Immune response	TAS	2142460
GO:0007165	Process	Signal transduction	TAS	2142460
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0009617	Process	Response to bacterium	ISS	26683154
GO:0009897	Component	External side of plasma membrane	ISS	26683154
GO:0010469	Process	Regulation of signaling receptor activity	TAS	26683154
GO:0016032	Process	Viral process	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	ISS	26683154
GO:0019772	Function	Low-affinity IgG receptor activity	IDA	2142460
GO:0019864	Function	IgG binding	IDA	2142460
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	ISS	26683154
GO:0021549	Process	Cerebellum development	ISS	26683154
GO:0030889	Process	Negative regulation of B cell proliferation	ISS	26683154
GO:0032693	Process	Negative regulation of interleukin-10 production	ISS	26683154
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IDA	2142460
GO:0043031	Process	Negative regulation of macrophage activation	TAS	26683154
GO:0043197	Component	Dendritic spine	ISS	26683154
GO:0043318	Process	Negative regulation of cytotoxic T cell degranulation	TAS	26683154
GO:0044297	Component	Cell body	ISS	26683154
GO:0044877	Function	Protein-containing complex binding	IPI	23921129
GO:0045088	Process	Regulation of innate immune response	TAS	26683154
GO:0045576	Process	Mast cell activation	ISS	26683154
GO:0046330	Process	Positive regulation of JNK cascade	ISS	23921129
GO:0050765	Process	Negative regulation of phagocytosis	TAS	26683154
GO:0050766	Process	Positive regulation of phagocytosis	ISS	26683154
GO:0050776	Process	Regulation of immune response	IBA	21873635
GO:0050776	Process	Regulation of immune response	TAS
GO:0050777	Process	Negative regulation of immune response	ISS	26683154
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IMP	24169826
GO:0050869	Process	Negative regulation of B cell activation	TAS	26683154
GO:0071219	Process	Cellular response to molecule of bacterial origin	ISS	26683154
GO:0090264	Process	Regulation of immune complex clearance by monocytes and macrophages	TAS	26683154
GO:1901216	Process	Positive regulation of neuron death	ISS	23921129
GO:1902564	Process	Negative regulation of neutrophil activation	TAS	26683154
GO:1902950	Process	Regulation of dendritic spine maintenance	IGI	23921129
GO:1904646	Process	Cellular response to amyloid-beta	ISS	23921129
GO:1905898	Process	Positive regulation of response to endoplasmic reticulum stress	ISS	23921129
GO:2001199	Process	Negative regulation of dendritic cell differentiation	TAS	26683154

MIM	HGNC	e!Ensembl
604590	3618	ENSG00000072694

Protein

UniProt ID

P31994

Protein name

Low affinity immunoglobulin gamma Fc region receptor II-b (IgG Fc receptor II-b) (CDw32) (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b) (CD antigen CD32)

Protein function

Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-ce

PDB

2FCB , 3WJJ , 5OCC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	49 → 128	Immunoglobulin domain	Domain
PF13895	Ig_2	132 → 214	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cel

Sequence

MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI

Sequence length

310

Interactions

View interactions

	KEGG		Reactome
	Virion - Ebolavirus, Lyssavirus and Morbillivirus Phagosome Osteoclast differentiation B cell receptor signaling pathway Fc gamma R-mediated phagocytosis Staphylococcus aureus infection Tuberculosis Measles		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia, Hemolytic	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)
Arthritis	Arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Autoimmune diseases	Autoimmune Diseases	rs869025224	10848805
Neutropenia	Neutropenia	rs879253882	10848805
Systemic lupus erythematosus	Systemic lupus erythematosus	rs72556554, rs1575496354, rs1307379746, rs758750492, rs1575497576

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Rheumatoid arthritis	Rheumatoid arthritis			GWAS

Show/Hide Text Mining Associations (70)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	34602489
Anemia Hemolytic Autoimmune	Associate	29692344
Arthritis	Associate	21911970
Arthritis Psoriatic	Associate	17521421
Arthritis Rheumatoid	Associate	15547078, 15593228, 17133580, 17521421, 18240208, 18633424, 20398308, 25340460, 27140173, 30963994, 34858391, 37108786
Arthritis Rheumatoid	Inhibit	20735866, 20850384
Asthma	Associate	24586589
Atrial Fibrillation	Inhibit	37581400
Atrophy	Associate	35755170
Autoimmune Diseases	Associate	12115230, 15703291, 19261857, 20385827, 20398308, 29692344
Breast Neoplasms	Associate	39874011
Carcinoma Hepatocellular	Associate	32191631
Carotid Artery Injuries	Associate	25022320
Chronic Periodontitis	Associate	30922293
Cryoglobulinemia Familial Mixed	Associate	21538321
Diabetic Retinopathy	Associate	36006018
Drug Hypersensitivity	Associate	30338531, 37861500
Drug Related Side Effects and Adverse Reactions	Associate	27856634
Fatty Liver Alcoholic	Associate	30695042
Fibrosis	Associate	30695042
Genetic Diseases Inborn	Associate	15153543
Glioblastoma	Associate	40429753
Glioma	Associate	37713871, 40429753
Glomerulonephritis IGA	Associate	23593433
Graves Disease	Inhibit	31033004
Hematuria	Associate	23593433
Hypothyroidism Congenital Nongoitrous 2	Associate	33893391
Ige Responsiveness Atopic	Associate	24586589
Infections	Associate	20385827
Inflammation	Associate	15703291, 17130130, 18240208, 30193587, 30695042, 36006018, 37108786
Inflammation	Inhibit	25340460
Joint Diseases	Associate	17133580
Leukemia	Associate	12010811
Leukemia Lymphocytic Chronic B Cell	Associate	12010811, 28372509
Leukemia Lymphocytic Chronic B Cell	Stimulate	14675408
Leukemia Prolymphocytic T Cell	Associate	21615384
Leukopenia	Associate	26084639
Lipid Metabolism Disorders	Associate	30695042
Lung Diseases Interstitial	Associate	30719970
Lupus Erythematosus Systemic	Associate	12115230, 15153543, 17130130, 17133600, 19005878, 20385827, 20508037, 21911970, 23261299, 25022320, 26084639, 27799621, 31343409, 34922596
Lymphoma B Cell	Associate	14675408, 21768293
Lymphoma Follicular	Associate	14675408, 19452316, 19672774, 34323957
Lymphoma Large B Cell Diffuse	Associate	14675408, 34323957, 34323958
Lymphoma Mantle Cell	Associate	21768293
Malaria	Associate	20385827
Mastocytoma	Associate	7964477
Meningitis Cryptococcal	Associate	22879986
Mucocutaneous Lymph Node Syndrome	Associate	22565545, 27893416
Multiple Sclerosis	Inhibit	33505402
Neoplasms	Associate	14508797, 15703291, 37713871
Nephritis	Associate	26084639
Non alcoholic Fatty Liver Disease	Associate	30695042
Oral Ulcer	Associate	21911970
Ovarian Neoplasms	Stimulate	39972314
Pancreatic Neoplasms	Associate	33845841
Peri Implantitis	Associate	34858391
Periodontitis	Associate	36148415, 36894919
Pleural Effusion	Associate	17133600
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	19261857
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	14508797
Proteinuria	Associate	23593433
Pulmonary Disease Chronic Obstructive	Associate	39780163
Purpura Thrombocytopenic Idiopathic	Associate	20507212, 21131591, 27281793, 29692344
Sarcoidosis	Associate	37174624
Scleroderma Systemic	Associate	30719970
Skin Manifestations	Associate	21911970
Soft Tissue Injuries	Associate	37108786
Spinal Cord Injuries	Associate	33863336
Thrombocytopenia	Associate	26084639
Wiskott Aldrich Syndrome	Inhibit	27330000

FCGR2B (Fc gamma receptor IIb)