LINC00305 (long intergenic non-protein coding RNA 305)

Gene Gene information from NCBI Gene database.
Gene miRNA Other IDs Protein
Entrez ID 221241
Gene name Long intergenic non-protein coding RNA 305
Gene symbol LINC00305
Synonyms (NCBI Gene)
C18orf20HsT1235NCRNA00305
Chromosome 18
Chromosome location 18q22.1
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT017894 hsa-miR-335-5p Microarray 18185580
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Other IDs Protein
MIM HGNC e!Ensembl
617489 28597 ENSG00000179676
Protein Protein information from UniProt database.
Gene miRNA Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z4B0
Protein name Putative uncharacterized protein encoded by LINC00305
Family and domains
Sequence 
MINLHRLCIIHVVATLLSTLLSLISVAISATCKDEKGKQEMETGQQPSGLSATLTKVKCA
KRQKTVVRVRFYMLSMKNKACRKNLSKGYNQRPEGSKEESHMVVKEKRKGDH
Sequence length 112
Interactions View interactions