FCGR2A (Fc gamma receptor IIa)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 2212
Gene name Fc gamma receptor IIa
Gene symbol FCGR2A
Synonyms (NCBI Gene)
CD32CD32ACDw32FCG2FCGR2FCGR2A1FcGRFcgammaRIIaIGFR2
Chromosome 1
Chromosome location 1q23.3
Summary This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and
SNPs SNP information provided by dbSNP.
1
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
SNP ID Visualize variation Clinical significance Consequence
rs1801274 A>C,G Benign, drug-response, risk-factor Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
72
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (72)
miRTarBase ID miRNA Experiments Reference
MIRT711491 hsa-miR-4275 HITS-CLIP 19536157
MIRT711490 hsa-miR-29b-2-5p HITS-CLIP 19536157
MIRT711489 hsa-miR-1305 HITS-CLIP 19536157
MIRT711491 hsa-miR-4275 HITS-CLIP 19536157
MIRT711490 hsa-miR-29b-2-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0001788 Process Antibody-dependent cellular cytotoxicity IBA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 2139735
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
146790 3616 ENSG00000143226
Protein Protein information from UniProt database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P12318
Protein name Low affinity immunoglobulin gamma Fc region receptor II-a (IgG Fc receptor II-a) (CDw32) (Fc-gamma RII-a) (Fc-gamma-RIIa) (FcRII-a) (CD antigen CD32)
Protein function Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
PDB 1FCG , 1H9V , 3D5O , 3RY4 , 3RY5 , 3RY6 , 8CHA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 40 → 119 Immunoglobulin domain Domain
PF13895 Ig_2 123 → 205 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Found on monocytes, neutrophils and eosinophil platelets.
Sequence 
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIY
CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD
KNIYLTLPPNDHVNSNN
Sequence length 317
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Phagosome
Osteoclast differentiation
Platelet activation
Neutrophil extracellular trap formation
Fc gamma R-mediated phagocytosis
Pathogenic Escherichia coli infection
Yersinia infection
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Coronavirus disease - COVID-19
Systemic lupus erythematosus 		  FCGR activation
Regulation of actin dynamics for phagocytic cup formation
Role of phospholipids in phagocytosis
Neutrophil degranulation
FCGR3A-mediated IL10 synthesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
21
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (15)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Uncertain significance rs409763 RCV005929838
Clear cell carcinoma of kidney Uncertain significance rs409763 RCV005929839
Colon adenocarcinoma Uncertain significance rs409763 RCV005929835
Cystic fibrosis Uncertain significance rs1675655979, rs409763 RCV002208746
RCV002204527
Show/Hide Text Mining Associations (153)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 18025239
Acute Disease Associate 15744239
Aggressive Periodontitis Associate 22167032
Altitude Sickness Inhibit 33393628
Alzheimer Disease Associate 31666081, 33081847, 34602489, 35954209
Angina Pectoris Associate 22559288
Angina Unstable Associate 22559288
Arthritis Associate 16542359, 24896836
Arthritis Juvenile Associate 12757620
Arthritis Rheumatoid Associate 10193433, 15593228, 17355628, 19898481, 23121884, 24802006, 25392121, 25848939, 31378115, 32508836, 39351328, 40081680