Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2212
Gene name Gene Name - the full gene name approved by the HGNC.
Fc gamma receptor IIa
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCGR2A
Synonyms (NCBI Gene) Gene synonyms aliases
CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, FcGR, FcgammaRIIa, IGFR2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1801274 A>C,G Benign, drug-response, risk-factor Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT711491 hsa-miR-4275 HITS-CLIP 19536157
MIRT711490 hsa-miR-29b-2-5p HITS-CLIP 19536157
MIRT711489 hsa-miR-1305 HITS-CLIP 19536157
MIRT711491 hsa-miR-4275 HITS-CLIP 19536157
MIRT711490 hsa-miR-29b-2-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001788 Process Antibody-dependent cellular cytotoxicity IBA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 2139735
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
146790 3616 ENSG00000143226
Protein
UniProt ID P12318
Protein name Low affinity immunoglobulin gamma Fc region receptor II-a (IgG Fc receptor II-a) (CDw32) (Fc-gamma RII-a) (Fc-gamma-RIIa) (FcRII-a) (CD antigen CD32)
Protein function Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
PDB 1FCG , 1H9V , 3D5O , 3RY4 , 3RY5 , 3RY6 , 8CHA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 40 119 Immunoglobulin domain Domain
PF13895 Ig_2 123 205 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Found on monocytes, neutrophils and eosinophil platelets.
Sequence
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTV
L
SEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITV
QVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIY
CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD
KNIYLTLPPNDHVNSNN
Sequence length 317
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Phagosome
Osteoclast differentiation
Platelet activation
Neutrophil extracellular trap formation
Fc gamma R-mediated phagocytosis
Pathogenic Escherichia coli infection
Yersinia infection
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Coronavirus disease - COVID-19
Systemic lupus erythematosus
  FCGR activation
Regulation of actin dynamics for phagocytic cup formation
Role of phospholipids in phagocytosis
Neutrophil degranulation
FCGR3A-mediated IL10 synthesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Diabetes Mild age-related type 2 diabetes N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease, Inflammatory bowel disease and other gasteroenteritis and colitis (PheCode 555), Inflammatory bowel disease (MTAG) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 18025239
Acute Disease Associate 15744239
Aggressive Periodontitis Associate 22167032
Altitude Sickness Inhibit 33393628
Alzheimer Disease Associate 31666081, 33081847, 34602489, 35954209
Angina Pectoris Associate 22559288
Angina Unstable Associate 22559288
Arthritis Associate 16542359, 24896836
Arthritis Juvenile Associate 12757620
Arthritis Rheumatoid Associate 10193433, 15593228, 17355628, 19898481, 23121884, 24802006, 25392121, 25848939, 31378115, 32508836, 39351328, 40081680