Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	221150
Gene name Gene Name - the full gene name approved by the HGNC.	Spindle and kinetochore associated complex subunit 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SKA3
Synonyms (NCBI Gene) Gene synonyms aliases	C13orf3, RAMA1
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q12.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromos

Show/Hide all(76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052469	hsa-let-7a-5p	CLASH	23622248
MIRT041438	hsa-miR-193b-3p	CLASH	23622248
MIRT739086	hsa-miR-148b	HITS-CLIP	33718276
MIRT739088	hsa-miR-148a	HITS-CLIP	33718276
MIRT1350847	hsa-miR-1206	CLIP-seq
MIRT1350848	hsa-miR-1207-5p	CLIP-seq
MIRT1350849	hsa-miR-1263	CLIP-seq
MIRT1350850	hsa-miR-1272	CLIP-seq
MIRT739104	hsa-miR-127-5p	CLIP-seq
MIRT1350851	hsa-miR-128	CLIP-seq
MIRT1350852	hsa-miR-1322	CLIP-seq
MIRT1350853	hsa-miR-133a	CLIP-seq
MIRT1350854	hsa-miR-133b	CLIP-seq
MIRT1350855	hsa-miR-1470	CLIP-seq
MIRT1350856	hsa-miR-1827	CLIP-seq
MIRT1350857	hsa-miR-203	CLIP-seq
MIRT1350858	hsa-miR-2053	CLIP-seq
MIRT1350859	hsa-miR-27a	CLIP-seq
MIRT1350860	hsa-miR-27b	CLIP-seq
MIRT1350861	hsa-miR-3064-5p	CLIP-seq
MIRT1350862	hsa-miR-3189-3p	CLIP-seq
MIRT1350863	hsa-miR-320a	CLIP-seq
MIRT1350864	hsa-miR-320b	CLIP-seq
MIRT1350865	hsa-miR-320c	CLIP-seq
MIRT1350866	hsa-miR-320d	CLIP-seq
MIRT1350867	hsa-miR-320e	CLIP-seq
MIRT1350868	hsa-miR-326	CLIP-seq
MIRT1350869	hsa-miR-330-5p	CLIP-seq
MIRT1350870	hsa-miR-3652	CLIP-seq
MIRT1350871	hsa-miR-3662	CLIP-seq
MIRT1350872	hsa-miR-3908	CLIP-seq
MIRT1350873	hsa-miR-3938	CLIP-seq
MIRT1350874	hsa-miR-3942-5p	CLIP-seq
MIRT1350875	hsa-miR-409-3p	CLIP-seq
MIRT1350876	hsa-miR-4422	CLIP-seq
MIRT1350877	hsa-miR-4429	CLIP-seq
MIRT1350878	hsa-miR-4430	CLIP-seq
MIRT1350879	hsa-miR-4487	CLIP-seq
MIRT1350880	hsa-miR-4505	CLIP-seq
MIRT1350881	hsa-miR-4506	CLIP-seq
MIRT739100	hsa-miR-4514	CLIP-seq
MIRT1350882	hsa-miR-4639-3p	CLIP-seq
MIRT739103	hsa-miR-4645-5p	CLIP-seq
MIRT739099	hsa-miR-4660	CLIP-seq
MIRT1350883	hsa-miR-4667-3p	CLIP-seq
MIRT739102	hsa-miR-4673	CLIP-seq
MIRT739101	hsa-miR-4692	CLIP-seq
MIRT1350884	hsa-miR-4703-5p	CLIP-seq
MIRT1350885	hsa-miR-4716-3p	CLIP-seq
MIRT1350886	hsa-miR-4738-3p	CLIP-seq
MIRT1350887	hsa-miR-4763-3p	CLIP-seq
MIRT1350888	hsa-miR-511	CLIP-seq
MIRT1350889	hsa-miR-513a-5p	CLIP-seq
MIRT739098	hsa-miR-516b	CLIP-seq
MIRT1350890	hsa-miR-545	CLIP-seq
MIRT1350891	hsa-miR-569	CLIP-seq
MIRT1350892	hsa-miR-593	CLIP-seq
MIRT1350893	hsa-miR-642a	CLIP-seq
MIRT1350894	hsa-miR-646	CLIP-seq
MIRT1350895	hsa-miR-656	CLIP-seq
MIRT1350896	hsa-miR-7	CLIP-seq
MIRT1350897	hsa-miR-885-3p	CLIP-seq
MIRT1350898	hsa-miR-940	CLIP-seq
MIRT2103941	hsa-miR-3607-5p	CLIP-seq
MIRT2103942	hsa-miR-3689a-5p	CLIP-seq
MIRT2103943	hsa-miR-3689b	CLIP-seq
MIRT2103944	hsa-miR-3689e	CLIP-seq
MIRT2103945	hsa-miR-3689f	CLIP-seq
MIRT2103946	hsa-miR-4520a-3p	CLIP-seq
MIRT739089	hsa-miR-132	CLIP-seq
MIRT739087	hsa-miR-152	CLIP-seq
MIRT739090	hsa-miR-212	CLIP-seq
MIRT1350874	hsa-miR-3942-5p	CLIP-seq
MIRT2459434	hsa-miR-4452	CLIP-seq
MIRT1350884	hsa-miR-4703-5p	CLIP-seq
MIRT1350890	hsa-miR-545	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IMP	19289083
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	20813266
GO:0000776	Component	Kinetochore	IEA
GO:0000776	Component	Kinetochore	IPI	21633384
GO:0000940	Component	Outer kinetochore	IBA
GO:0000940	Component	Outer kinetochore	IDA	19289083, 19646878, 28479321
GO:0000940	Component	Outer kinetochore	IEA
GO:0005515	Function	Protein binding	IPI	19289083, 19360002, 26496610, 28479321, 28514442, 31515488, 32296183, 33961781
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	19646878
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0005876	Component	Spindle microtubule	IDA	19289083
GO:0007056	Process	Spindle assembly involved in female meiosis	IEA
GO:0007056	Process	Spindle assembly involved in female meiosis	ISS
GO:0007059	Process	Chromosome segregation	IBA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IPI	28495837
GO:0008017	Function	Microtubule binding	IDA	29487209
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IDA	19289083
GO:0051296	Process	Establishment of meiotic spindle orientation	IEA
GO:0051296	Process	Establishment of meiotic spindle orientation	ISS
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase chromosome alignment	IMP	22371557
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	29487209
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	28479321
GO:0072686	Component	Mitotic spindle	IDA	19646878
GO:0072687	Component	Meiotic spindle	IEA
GO:0140499	Process	Negative regulation of mitotic spindle assembly checkpoint signaling	IMP	19646878
GO:0170027	Component	SKA complex	IDA	31804178

MIM	HGNC	e!Ensembl
619247	20262	ENSG00000165480

Protein

UniProt ID

Q8IX90

Protein name

Spindle and kinetochore-associated protein 3

Protein function

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:19289083, PubMed:19360002, PubMed:23085020). The SKA1 complex is a direct component of the kinet

PDB

4AJ5

Family and domains

Sequence

MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNI
LLDKARLENQEGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSD
PELSNCENFQKTDVKDDLSDPPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVN
NYKEEPVIVTPPTKQSLVKVLKTPKCALKMDDFECVTPKLEHFGISEYTMCLNEDYTMGL
KNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEYTNSPLVPTFCTPGLKIPSTK
NSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPT
PPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN

Sequence length

412

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	23496902, 32799774, 37180139
Carcinogenesis	Associate	30402980, 35546682
Carcinoma Hepatocellular	Associate	34045512
Cardiotoxicity	Associate	34544967
Cholangiocarcinoma	Associate	37821935
Chromosomal Instability	Stimulate	27329586
Colorectal Neoplasms	Associate	27329586
Drug Related Side Effects and Adverse Reactions	Associate	34544967
Heart Failure	Associate	34544967
Hypoxia	Stimulate	37821935
Hypoxia Brain	Associate	37821935
Intervertebral Disc Degeneration	Associate	34545328
Lung Neoplasms	Associate	34806315
Medulloblastoma	Associate	30402980
Multiple Myeloma	Associate	35689754
Neoplasm Metastasis	Stimulate	34845974
Neoplasms	Associate	23496902, 32902196, 34045512, 35546682, 37180139, 37821935
Polyposis Syndrome Hereditary Mixed 1	Associate	27329586
Stomach Neoplasms	Associate	32902196
Urinary Bladder Neoplasms	Associate	35546682
Uterine Cervical Neoplasms	Associate	32799774

SKA3 (spindle and kinetochore associated complex subunit 3)