Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	221150
Gene name	Spindle and kinetochore associated complex subunit 3
Gene symbol	SKA3
Synonyms (NCBI Gene)	C13orf3RAMA1
Chromosome	13
Chromosome location	13q12.11
Summary	This gene encodes a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromos

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052469	hsa-let-7a-5p	CLASH	23622248
MIRT041438	hsa-miR-193b-3p	CLASH	23622248
MIRT739086	hsa-miR-148b	HITS-CLIP	33718276
MIRT739088	hsa-miR-148a	HITS-CLIP	33718276
MIRT1350847	hsa-miR-1206	CLIP-seq
MIRT1350848	hsa-miR-1207-5p	CLIP-seq
MIRT1350849	hsa-miR-1263	CLIP-seq
MIRT1350850	hsa-miR-1272	CLIP-seq
MIRT739104	hsa-miR-127-5p	CLIP-seq
MIRT1350851	hsa-miR-128	CLIP-seq
MIRT1350852	hsa-miR-1322	CLIP-seq
MIRT1350853	hsa-miR-133a	CLIP-seq
MIRT1350854	hsa-miR-133b	CLIP-seq
MIRT1350855	hsa-miR-1470	CLIP-seq
MIRT1350856	hsa-miR-1827	CLIP-seq
MIRT1350857	hsa-miR-203	CLIP-seq
MIRT1350858	hsa-miR-2053	CLIP-seq
MIRT1350859	hsa-miR-27a	CLIP-seq
MIRT1350860	hsa-miR-27b	CLIP-seq
MIRT1350861	hsa-miR-3064-5p	CLIP-seq
MIRT1350862	hsa-miR-3189-3p	CLIP-seq
MIRT1350863	hsa-miR-320a	CLIP-seq
MIRT1350864	hsa-miR-320b	CLIP-seq
MIRT1350865	hsa-miR-320c	CLIP-seq
MIRT1350866	hsa-miR-320d	CLIP-seq
MIRT1350867	hsa-miR-320e	CLIP-seq
MIRT1350868	hsa-miR-326	CLIP-seq
MIRT1350869	hsa-miR-330-5p	CLIP-seq
MIRT1350870	hsa-miR-3652	CLIP-seq
MIRT1350871	hsa-miR-3662	CLIP-seq
MIRT1350872	hsa-miR-3908	CLIP-seq
MIRT1350873	hsa-miR-3938	CLIP-seq
MIRT1350874	hsa-miR-3942-5p	CLIP-seq
MIRT1350875	hsa-miR-409-3p	CLIP-seq
MIRT1350876	hsa-miR-4422	CLIP-seq
MIRT1350877	hsa-miR-4429	CLIP-seq
MIRT1350878	hsa-miR-4430	CLIP-seq
MIRT1350879	hsa-miR-4487	CLIP-seq
MIRT1350880	hsa-miR-4505	CLIP-seq
MIRT1350881	hsa-miR-4506	CLIP-seq
MIRT739100	hsa-miR-4514	CLIP-seq
MIRT1350882	hsa-miR-4639-3p	CLIP-seq
MIRT739103	hsa-miR-4645-5p	CLIP-seq
MIRT739099	hsa-miR-4660	CLIP-seq
MIRT1350883	hsa-miR-4667-3p	CLIP-seq
MIRT739102	hsa-miR-4673	CLIP-seq
MIRT739101	hsa-miR-4692	CLIP-seq
MIRT1350884	hsa-miR-4703-5p	CLIP-seq
MIRT1350885	hsa-miR-4716-3p	CLIP-seq
MIRT1350886	hsa-miR-4738-3p	CLIP-seq
MIRT1350887	hsa-miR-4763-3p	CLIP-seq
MIRT1350888	hsa-miR-511	CLIP-seq
MIRT1350889	hsa-miR-513a-5p	CLIP-seq
MIRT739098	hsa-miR-516b	CLIP-seq
MIRT1350890	hsa-miR-545	CLIP-seq
MIRT1350891	hsa-miR-569	CLIP-seq
MIRT1350892	hsa-miR-593	CLIP-seq
MIRT1350893	hsa-miR-642a	CLIP-seq
MIRT1350894	hsa-miR-646	CLIP-seq
MIRT1350895	hsa-miR-656	CLIP-seq
MIRT1350896	hsa-miR-7	CLIP-seq
MIRT1350897	hsa-miR-885-3p	CLIP-seq
MIRT1350898	hsa-miR-940	CLIP-seq
MIRT2103941	hsa-miR-3607-5p	CLIP-seq
MIRT2103942	hsa-miR-3689a-5p	CLIP-seq
MIRT2103943	hsa-miR-3689b	CLIP-seq
MIRT2103944	hsa-miR-3689e	CLIP-seq
MIRT2103945	hsa-miR-3689f	CLIP-seq
MIRT2103946	hsa-miR-4520a-3p	CLIP-seq
MIRT739089	hsa-miR-132	CLIP-seq
MIRT739087	hsa-miR-152	CLIP-seq
MIRT739090	hsa-miR-212	CLIP-seq
MIRT1350874	hsa-miR-3942-5p	CLIP-seq
MIRT2459434	hsa-miR-4452	CLIP-seq
MIRT1350884	hsa-miR-4703-5p	CLIP-seq
MIRT1350890	hsa-miR-545	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IMP	19289083
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	20813266
GO:0000776	Component	Kinetochore	IEA
GO:0000776	Component	Kinetochore	IPI	21633384
GO:0000940	Component	Outer kinetochore	IBA
GO:0000940	Component	Outer kinetochore	IDA	19289083, 19646878, 28479321
GO:0000940	Component	Outer kinetochore	IEA
GO:0005515	Function	Protein binding	IPI	19289083, 19360002, 26496610, 28479321, 28514442, 31515488, 32296183, 33961781
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	19646878
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0005876	Component	Spindle microtubule	IDA	19289083
GO:0007056	Process	Spindle assembly involved in female meiosis	IEA
GO:0007056	Process	Spindle assembly involved in female meiosis	ISS
GO:0007059	Process	Chromosome segregation	IBA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IPI	28495837
GO:0008017	Function	Microtubule binding	IDA	29487209
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IDA	19289083
GO:0051296	Process	Establishment of meiotic spindle orientation	IEA
GO:0051296	Process	Establishment of meiotic spindle orientation	ISS
GO:0051301	Process	Cell division	IEA
GO:0051310	Process	Metaphase chromosome alignment	IMP	22371557
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	29487209
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	28479321
GO:0072686	Component	Mitotic spindle	IDA	19646878
GO:0072687	Component	Meiotic spindle	IEA
GO:0140499	Process	Negative regulation of mitotic spindle assembly checkpoint signaling	IMP	19646878
GO:0170027	Component	SKA complex	IDA	31804178

MIM	HGNC	e!Ensembl
619247	20262	ENSG00000165480

Q8IX90

Protein name

Spindle and kinetochore-associated protein 3

Protein function

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:19289083, PubMed:19360002, PubMed:23085020). The SKA1 complex is a direct component of the kinet

PDB

4AJ5

Family and domains

Sequence

MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNI
LLDKARLENQEGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSD
PELSNCENFQKTDVKDDLSDPPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVN
NYKEEPVIVTPPTKQSLVKVLKTPKCALKMDDFECVTPKLEHFGISEYTMCLNEDYTMGL
KNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEYTNSPLVPTFCTPGLKIPSTK
NSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPT
PPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN

Sequence length

412

Interactions

View interactions

SKA3 (spindle and kinetochore associated complex subunit 3)