Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	221120
Gene name	AlkB homolog 3, alpha-ketoglutarate dependent dioxygenase
Gene symbol	ALKBH3
Synonyms (NCBI Gene)	ABH3DEPC-1DEPC1PCA1hABH3
Chromosome	11
Chromosome location	11p11.2
Summary	The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methy

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT714528	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT714527	hsa-miR-3928-5p	HITS-CLIP	19536157
MIRT714526	hsa-miR-6806-3p	HITS-CLIP	19536157
MIRT714525	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT714524	hsa-miR-127-5p	HITS-CLIP	19536157
MIRT714523	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714522	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714528	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT714527	hsa-miR-3928-5p	HITS-CLIP	19536157
MIRT714526	hsa-miR-6806-3p	HITS-CLIP	19536157
MIRT714525	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT714524	hsa-miR-127-5p	HITS-CLIP	19536157
MIRT714523	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714522	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT778749	hsa-miR-4470	CLIP-seq
MIRT778750	hsa-miR-495	CLIP-seq
MIRT2473272	hsa-miR-1226	CLIP-seq
MIRT2473273	hsa-miR-1260	CLIP-seq
MIRT2473274	hsa-miR-1260b	CLIP-seq
MIRT2473275	hsa-miR-1273g	CLIP-seq
MIRT2473276	hsa-miR-15a	CLIP-seq
MIRT2473277	hsa-miR-15b	CLIP-seq
MIRT2473278	hsa-miR-16	CLIP-seq
MIRT2473279	hsa-miR-188-3p	CLIP-seq
MIRT2473280	hsa-miR-195	CLIP-seq
MIRT2473281	hsa-miR-219-1-3p	CLIP-seq
MIRT2473282	hsa-miR-29a	CLIP-seq
MIRT2473283	hsa-miR-29b	CLIP-seq
MIRT2473284	hsa-miR-29c	CLIP-seq
MIRT2473285	hsa-miR-3064-3p	CLIP-seq
MIRT2473286	hsa-miR-3065-3p	CLIP-seq
MIRT2473287	hsa-miR-3117-3p	CLIP-seq
MIRT2473288	hsa-miR-3119	CLIP-seq
MIRT2473289	hsa-miR-3128	CLIP-seq
MIRT2473290	hsa-miR-3145-5p	CLIP-seq
MIRT2473291	hsa-miR-3152-5p	CLIP-seq
MIRT2473292	hsa-miR-3156-3p	CLIP-seq
MIRT2473293	hsa-miR-3160-3p	CLIP-seq
MIRT2473294	hsa-miR-3162-5p	CLIP-seq
MIRT2473295	hsa-miR-3169	CLIP-seq
MIRT2473296	hsa-miR-320e	CLIP-seq
MIRT2473297	hsa-miR-3682-3p	CLIP-seq
MIRT2473298	hsa-miR-3684	CLIP-seq
MIRT2473299	hsa-miR-376c	CLIP-seq
MIRT2473300	hsa-miR-411	CLIP-seq
MIRT2473301	hsa-miR-424	CLIP-seq
MIRT778749	hsa-miR-4470	CLIP-seq
MIRT2473302	hsa-miR-4487	CLIP-seq
MIRT2473303	hsa-miR-4524	CLIP-seq
MIRT2473304	hsa-miR-4729	CLIP-seq
MIRT2473305	hsa-miR-4744	CLIP-seq
MIRT2473306	hsa-miR-4759	CLIP-seq
MIRT2473307	hsa-miR-4774-3p	CLIP-seq
MIRT2473308	hsa-miR-4775	CLIP-seq
MIRT2473309	hsa-miR-497	CLIP-seq
MIRT2473310	hsa-miR-503	CLIP-seq
MIRT2473311	hsa-miR-556-3p	CLIP-seq
MIRT2473312	hsa-miR-558	CLIP-seq
MIRT2473313	hsa-miR-571	CLIP-seq
MIRT2473314	hsa-miR-579	CLIP-seq
MIRT2473315	hsa-miR-633	CLIP-seq
MIRT2473316	hsa-miR-646	CLIP-seq
MIRT2473317	hsa-miR-936	CLIP-seq
MIRT2473273	hsa-miR-1260	CLIP-seq
MIRT2473274	hsa-miR-1260b	CLIP-seq
MIRT2473275	hsa-miR-1273g	CLIP-seq
MIRT2473279	hsa-miR-188-3p	CLIP-seq
MIRT2473281	hsa-miR-219-1-3p	CLIP-seq
MIRT2473285	hsa-miR-3064-3p	CLIP-seq
MIRT2473288	hsa-miR-3119	CLIP-seq
MIRT2473291	hsa-miR-3152-5p	CLIP-seq
MIRT2473292	hsa-miR-3156-3p	CLIP-seq
MIRT2473293	hsa-miR-3160-3p	CLIP-seq
MIRT2473294	hsa-miR-3162-5p	CLIP-seq
MIRT2473297	hsa-miR-3682-3p	CLIP-seq
MIRT2473298	hsa-miR-3684	CLIP-seq
MIRT2473299	hsa-miR-376c	CLIP-seq
MIRT2473300	hsa-miR-411	CLIP-seq
MIRT2473302	hsa-miR-4487	CLIP-seq
MIRT2473304	hsa-miR-4729	CLIP-seq
MIRT2473305	hsa-miR-4744	CLIP-seq
MIRT2473307	hsa-miR-4774-3p	CLIP-seq
MIRT2473308	hsa-miR-4775	CLIP-seq
MIRT2473311	hsa-miR-556-3p	CLIP-seq
MIRT2473312	hsa-miR-558	CLIP-seq
MIRT2473313	hsa-miR-571	CLIP-seq
MIRT2473314	hsa-miR-579	CLIP-seq
MIRT2473315	hsa-miR-633	CLIP-seq
MIRT2473317	hsa-miR-936	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22055184, 25416956, 29892012, 31515488, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006307	Process	DNA alkylation repair	IDA	20714506, 22055184
GO:0006307	Process	DNA alkylation repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008198	Function	Ferrous iron binding	IDA	16858410
GO:0008283	Process	Cell population proliferation	IMP	22055184
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031418	Function	L-ascorbic acid binding	IEA
GO:0035515	Function	Oxidative RNA demethylase activity	IDA	16174769
GO:0035515	Function	Oxidative RNA demethylase activity	IEA
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IDA	12486230, 16174769, 16858410, 20714506
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IEA
GO:0035516	Function	Broad specificity oxidative DNA demethylase activity	IMP	22055184
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:1990930	Function	MRNA N1-methyladenosine dioxygenase activity	IDA	26863196, 26863410
GO:1990930	Function	MRNA N1-methyladenosine dioxygenase activity	IEA
GO:2000766	Process	Negative regulation of cytoplasmic translation	IDA	26863196

MIM	HGNC	e!Ensembl
610603	30141	ENSG00000166199

Q96Q83

Protein name

Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (EC 1.14.11.33) (EC 1.14.11.54) (Alkylated DNA repair protein alkB homolog 3) (hABH3) (DEPC-1) (Prostate cancer antigen 1)

Protein function

Dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A) (PubMed:12486230, PubMed:12594517, PubMed:16174769, PubMed:26863196, PubMed:26863410). Repairs alkylated DNA containing 1-methyladenosine (m1A) and 3-methy

PDB

2IUW , 8JNK , 8JNR , 9NCZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13532	2OG-FeII_Oxy_2	89 → 275	2OG-Fe(II) oxygenase superfamily	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon. {ECO:0000269|PubMed:12486230, ECO:0000269|PubMed:16174769, ECO:

Sequence

MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQ
QVVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTG
IREDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNL
YRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLD
HGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW

Sequence length

286

Interactions

View interactions

	Reactome
			ALKBH3 mediated reversal of alkylation damage

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	28679371	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	36098205	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	36098205	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	35867754, 36459535	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	19852088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Associate	17968469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	17968469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	31519943	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	21642358	★★★★★ ★☆☆☆☆ Found in Text Mining only

ALKBH3 (alkB homolog 3, alpha-ketoglutarate dependent dioxygenase)