Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	221074
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 39 member 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC39A12
Synonyms (NCBI Gene) Gene synonyms aliases	LZT-Hs8, ZIP-12, ZIP12, bA570F3.1
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10p12.33
Summary Summary of gene provided in NCBI Entrez Gene.	Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12 belongs to a subfamily

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019023	hsa-miR-335-5p	Microarray	18185580
MIRT1363199	hsa-miR-2681	CLIP-seq
MIRT1363200	hsa-miR-3978	CLIP-seq
MIRT1363201	hsa-miR-4261	CLIP-seq
MIRT1363202	hsa-miR-4694-5p	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001841	Process	Neural tube formation	ISS
GO:0005385	Function	Zinc ion transmembrane transporter activity	IBA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IEA
GO:0005385	Function	Zinc ion transmembrane transporter activity	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006829	Process	Zinc ion transport	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0015701	Process	Bicarbonate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0030001	Process	Metal ion transport	IEA
GO:0030003	Process	Intracellular monoatomic cation homeostasis	IBA
GO:0031113	Process	Regulation of microtubule polymerization	IEA
GO:0046873	Function	Metal ion transmembrane transporter activity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071578	Process	Zinc ion import across plasma membrane	IBA
GO:0071578	Process	Zinc ion import across plasma membrane	IEA
GO:0071578	Process	Zinc ion import across plasma membrane	ISS
GO:0140410	Function	Monoatomic cation:bicarbonate symporter activity	IBA
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1990138	Process	Neuron projection extension	ISS

MIM	HGNC	e!Ensembl
608734	20860	ENSG00000148482

Protein

UniProt ID

Q504Y0

Protein name

Zinc transporter ZIP12 (LIV-1 subfamily of ZIP zinc transporter 8) (LZT-Hs8) (Solute carrier family 39 member 12) (Zrt- and Irt-like protein 12) (ZIP-12)

Protein function

Uniporter that promotes Zn(2+) import from the extracellular space to the cytoplasm across the cell membrane. The transport activity is temperature dependent. May play a role in neurulation and neurite extension. May play a key role in maintaini

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18292	ZIP4_domain	63 → 222	Zinc transporter ZIP4 domain	Domain
PF02535	Zip	364 → 683	ZIP Zinc transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and eye. {ECO:0000269|PubMed:12107410, ECO:0000269|PubMed:15342556}.

Sequence

MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNH
SRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLY
YIIHQEEICSSKLNMSNKEYKFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQS
QCMETKTLQKKSGIVSSEGANESTLPQLAAMIITLSLQGVCLGQGNLPSPDYFTEYIFSS
LNRTNTLRLSELDQLLNTLWTRSTCIKNEKIHQFQRKQNNIITHDQDYSNFSSSMEKESE
DGPVSWDQTCFSARQLVEIFLQKGLSLISKEDFKQMSPGIIQQLLSCSCHLPKDQQAKLP
PTTLEKYGYSTVAVTLLTLGSMLGTALVLFHSCEENYRLILQLFVGLAVGTLSGDALLHL
IPQVLGLHKQEAPEFGHFHESKGHIWKLMGLIGGIHGFFLIEKCFILLVSPNDKQGLSLV
NGHVGHSHHLALNSELSDQAGRGKSASTIQLKSPEDSQAAEMPIGSMTASNRKCKAISLL
AIMILVGDSLHNFADGLAIGAAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMK
TAILMNFISSLTAFMGLYIGLSVSADPCVQDWIFTVTAGMFLYLSLVEMLPEMTHVQTQR
PWMMFLLQNFGLILGWLSLLLLAIYEQNIKI

Sequence length

691

Interactions

View interactions

	KEGG
	Alzheimer disease Parkinson disease

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypertension	Hypertension	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	32744318
Dystonic Disorders	Associate	35486108
Refsum Disease Infantile	Associate	35486108
Retinal Degeneration	Associate	35486108

SLC39A12 (solute carrier family 39 member 12)