Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
221035
Gene name Gene Name - the full gene name approved by the HGNC.
Receptor accessory protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
REEP3
Synonyms (NCBI Gene) Gene synonyms aliases
C10orf74, Yip2b
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q21.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016063 hsa-miR-374b-5p Sequencing 20371350
MIRT016224 hsa-miR-590-3p Sequencing 20371350
MIRT018792 hsa-miR-335-5p Microarray 18185580
MIRT020016 hsa-miR-375 Microarray 20215506
MIRT025553 hsa-miR-34a-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15778465, 32296183, 36931259
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005874 Component Microtubule IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609348 23711 ENSG00000165476
Protein
UniProt ID Q6NUK4
Protein name Receptor expression-enhancing protein 3
Protein function Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03134 TB2_DP1_HVA22 19 95 TB2/DP1, HVA22 family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in circumvallate papillae. {ECO:0000269|PubMed:16720576}.
Sequence
MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA
WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPL
LSSKEREIDDYIVQAKERGYETMVN
FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS
KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY
GSLKYKVKKRPQVYF
Sequence length 255
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Olfactory Signaling Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Age of onset of adult onset asthma N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Cholelithiasis Cholelithiasis N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Fetal Alcohol Spectrum Disorders Associate 37047575
Neuroblastoma Associate 29042551
Obesity Associate 26602056
Obsessive Compulsive Disorder Associate 29042551
Osteosarcoma Associate 36408691
Overweight Associate 26602056