Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
221035
Gene name Gene Name - the full gene name approved by the HGNC.
Receptor accessory protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
REEP3
Synonyms (NCBI Gene) Gene synonyms aliases
C10orf74, Yip2b
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q21.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016063 hsa-miR-374b-5p Sequencing 20371350
MIRT016224 hsa-miR-590-3p Sequencing 20371350
MIRT018792 hsa-miR-335-5p Microarray 18185580
MIRT020016 hsa-miR-375 Microarray 20215506
MIRT025553 hsa-miR-34a-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005789 Component Endoplasmic reticulum membrane IBA 21873635
GO:0005881 Component Cytoplasmic microtubule IBA 21873635
GO:0006998 Process Nuclear envelope organization IMP 23911198
GO:0007084 Process Mitotic nuclear envelope reassembly IMP 23911198
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609348 23711 ENSG00000165476
Protein
UniProt ID Q6NUK4
Protein name Receptor expression-enhancing protein 3
Protein function Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03134 TB2_DP1_HVA22 19 95 TB2/DP1, HVA22 family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in circumvallate papillae. {ECO:0000269|PubMed:16720576}.
Sequence
MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA
WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPL
LSSKEREIDDYIVQAKERGYETMVN
FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS
KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY
GSLKYKVKKRPQVYF
Sequence length 255
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Olfactory Signaling Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 22354554
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
30061737, 29892015
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
17290275
Unknown
Disease term Disease name Evidence References Source
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 29892015 ClinVar
Atrial Fibrillation Atrial Fibrillation GWAS
Diabetes Diabetes GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Fetal Alcohol Spectrum Disorders Associate 37047575
Neuroblastoma Associate 29042551
Obesity Associate 26602056
Obsessive Compulsive Disorder Associate 29042551
Osteosarcoma Associate 36408691
Overweight Associate 26602056