MARCHF8 (membrane associated ring-CH-type finger 8)

Gene

• Entrez ID: 220972
• Gene name: Membrane associated ring-CH-type finger 8
• Gene symbol: MARCHF8
• Synonyms (NCBI Gene): CMIR, MARCH-VIII, MARCH8, MIR, RNF178, c-MIR
• Chromosome: 10
• Chromosome location: 10q11.21-q11.22
• Summary: MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. M

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0000209	Process	Protein polyubiquitination	IDA	19117940
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002495	Process	Antigen processing and presentation of peptide antigen via MHC class II	IBA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	14722266, 19117940
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	14722266
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IDA	14722266
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006955	Process	Immune response	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IBA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	IBA
GO:0042287	Function	MHC protein binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

Other IDs

• MIM: 613335
• HGNC: 23356
• e!Ensembl: ENSG00000165406

Protein

• UniProt ID: Q5T0T0
• Protein name: E3 ubiquitin-protein ligase MARCHF8 (EC 2.3.2.27) (Cellular modulator of immune recognition) (c-MIR) (Membrane-associated RING finger protein 8) (Membrane-associated RING-CH protein VIII) (MARCH-VIII) (RING finger protein 178) (RING-type E3 ubiquitin tran
• Protein function: E3 ubiquitin-protein ligase that plays several important roles in innate immunity and adaptive immunity (PubMed:34285233, PubMed:35019698, PubMed:35503863). Mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta
• PDB: 2D8S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12906	RINGv	80 → 126	RING-variant domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Broadly expressed. Present in immature dendritic cells (at protein level). {ECO:0000269|PubMed:12582153, ECO:0000269|PubMed:14722266}.
• Sequence:

  MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASA
  PAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDT
  RCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRT
  AEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQN
  CPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV

• Sequence length: 291