Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2208
Gene name Gene Name - the full gene name approved by the HGNC.	Fc epsilon receptor II
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FCER2
Synonyms (NCBI Gene) Gene synonyms aliases	BLAST-2, CD23, CD23A, CLEC4J, FCE2, FCErII, IGEBF
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, the

Show/Hide all(11)

miRTarBase ID	miRNA	Experiments
MIRT2228842	hsa-miR-1182	CLIP-seq
MIRT2228843	hsa-miR-1275	CLIP-seq
MIRT2228844	hsa-miR-193a-5p	CLIP-seq
MIRT2228845	hsa-miR-3127-5p	CLIP-seq
MIRT2228846	hsa-miR-3194-3p	CLIP-seq
MIRT2228847	hsa-miR-431	CLIP-seq
MIRT2228848	hsa-miR-4665-5p	CLIP-seq
MIRT2532381	hsa-miR-185	CLIP-seq
MIRT2532382	hsa-miR-4306	CLIP-seq
MIRT2532383	hsa-miR-4644	CLIP-seq
MIRT2532384	hsa-miR-516b	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
BCL6	Repression	11342629
EGR1	Repression	9300687
IRF4	Activation	11342629
PAX5	Unknown	12731041
STAT6	Activation	9686563

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	12777399
GO:0002450	Process	B cell antigen processing and presentation	IDA	2167225
GO:0002925	Process	Positive regulation of humoral immune response mediated by circulating immunoglobulin	IEA
GO:0005178	Function	Integrin binding	TAS	2529542
GO:0005515	Function	Protein binding	IPI	16172256, 25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	7544003
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2529542
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	7544003
GO:0016020	Component	Membrane	IEA
GO:0019769	Function	Low-affinity IgE receptor activity	IDA	7544003
GO:0019863	Function	IgE binding	IDA	16172256
GO:0019863	Function	IgE binding	IEA
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IDA	7544003
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0042116	Process	Macrophage activation	IDA	7544003
GO:0042742	Process	Defense response to bacterium	IDA	7544003
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0160006	Process	Fc receptor-mediated immune complex endocytosis	IDA	2167225

MIM	HGNC	e!Ensembl
151445	3612	ENSG00000104921

Protein

UniProt ID

P06734

Protein name

Low affinity immunoglobulin epsilon Fc receptor (BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc recepto

Protein function

Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B cells. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells (PubMed:

PDB

1T8C , 1T8D , 2H2R , 2H2T , 4EZM , 4G96 , 4G9A , 4GI0 , 4GJ0 , 4GJX , 4GK1 , 4GKO , 4J6J , 4J6K , 4J6L , 4J6M , 4J6N , 4J6P , 4J6Q , 4KI1 , 5LGK , 6Y0L , 6Y0M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	180 → 284	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in urine (at protein level). {ECO:0000269|PubMed:37453717}.

Sequence

MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS

Sequence length

321

Interactions

View interactions

	KEGG		Reactome
	Hematopoietic cell lineage Epstein-Barr virus infection		NOTCH2 intracellular domain regulates transcription Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling

FCER2 (Fc epsilon receptor II)