FCER2 (Fc epsilon receptor II)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2208
Gene name Gene Name - the full gene name approved by the HGNC.
Fc epsilon receptor II
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCER2
Synonyms (NCBI Gene) Gene synonyms aliases
BLAST-2, CD23, CD23A, CLEC4J, FCE2, FCErII, IGEBF
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, the
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT2228842 hsa-miR-1182 CLIP-seq
MIRT2228843 hsa-miR-1275 CLIP-seq
MIRT2228844 hsa-miR-193a-5p CLIP-seq
MIRT2228845 hsa-miR-3127-5p CLIP-seq
MIRT2228846 hsa-miR-3194-3p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
Transcription factor Regulation Reference
BCL6 Repression 11342629
EGR1 Repression 9300687
IRF4 Activation 11342629
PAX5 Unknown 12731041
STAT6 Activation 9686563
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0002925 Process Positive regulation of humoral immune response mediated by circulating immunoglobulin IEA
GO:0005178 Function Integrin binding TAS 2529542
GO:0005515 Function Protein binding IPI 25416956
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane TAS 2529542
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
151445 3612 ENSG00000104921
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P06734
Protein name Low affinity immunoglobulin epsilon Fc receptor (BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc recepto
Protein function Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B cells. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells (PubMed:
PDB 1T8C , 1T8D , 2H2R , 2H2T , 4EZM , 4G96 , 4G9A , 4GI0 , 4GJ0 , 4GJX , 4GK1 , 4GKO , 4J6J , 4J6K , 4J6L , 4J6M , 4J6N , 4J6P , 4J6Q , 4KI1 , 5LGK , 6Y0L , 6Y0M
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 180 → 284 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in urine (at protein level). {ECO:0000269|PubMed:37453717}.
Sequence 
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS
Sequence length 321
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Hematopoietic cell lineage
Epstein-Barr virus infection 		  NOTCH2 intracellular domain regulates transcription
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Parkinson disease Parkinson Disease rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432
View all (84 more)		 25475535
Show/Hide Text Mining Associations (102)
Associations from Text Mining
Disease Name Relationship Type References
Alveolitis Extrinsic Allergic Associate 2139100
Alzheimer Disease Associate 9394977
Anemia Inhibit 11920534
Arthritis Associate 1827636
Arthritis Rheumatoid Associate 1829991, 2532990, 30649469
Asthma Associate 37076662, 8222326
Autistic Disorder Associate 24884537
Autoimmune Diseases Associate 22615937
Autoimmune enteropathy Associate 8244467
Bone Marrow Diseases Stimulate 31054894