Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2207
Gene name Gene Name - the full gene name approved by the HGNC.	Fc epsilon receptor Ig
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FCER1G
Synonyms (NCBI Gene) Gene synonyms aliases	FCRG
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054333	hsa-miR-1225-3p	Microarray, qRT-PCR	23593351
MIRT993751	hsa-miR-2110	CLIP-seq
MIRT993752	hsa-miR-3135b	CLIP-seq
MIRT993753	hsa-miR-4259	CLIP-seq
MIRT993754	hsa-miR-4271	CLIP-seq
MIRT993755	hsa-miR-4425	CLIP-seq
MIRT993756	hsa-miR-4653-3p	CLIP-seq
MIRT993757	hsa-miR-4725-3p	CLIP-seq
MIRT993758	hsa-miR-571	CLIP-seq
MIRT2228832	hsa-miR-3616-3p	CLIP-seq
MIRT2228833	hsa-miR-3652	CLIP-seq
MIRT2228834	hsa-miR-4430	CLIP-seq
MIRT2228835	hsa-miR-4446-3p	CLIP-seq
MIRT2228836	hsa-miR-4492	CLIP-seq
MIRT2228837	hsa-miR-4498	CLIP-seq
MIRT2228838	hsa-miR-4721	CLIP-seq
MIRT2228839	hsa-miR-548b-3p	CLIP-seq
MIRT2228840	hsa-miR-7	CLIP-seq
MIRT2228841	hsa-miR-762	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002283	Process	Neutrophil activation involved in immune response	IBA	21873635
GO:0002292	Process	T cell differentiation involved in immune response	IBA	21873635
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8810294, 9280292, 16735691, 26311901, 29143175
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	16735691
GO:0007596	Process	Blood coagulation	TAS
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009986	Component	Cell surface	IDA	1535625
GO:0010543	Process	Regulation of platelet activation	IBA	21873635
GO:0016064	Process	Immunoglobulin mediated immune response	IBA	21873635
GO:0019767	Function	IgE receptor activity	IBA	21873635
GO:0019863	Function	IgE binding	IEA
GO:0019864	Function	IgG binding	IBA	21873635
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA	21873635
GO:0030168	Process	Platelet activation	TAS
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0031623	Process	Receptor internalization	ISS
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0032998	Component	Fc-epsilon receptor I complex	IBA	21873635
GO:0038094	Process	Fc-gamma receptor signaling pathway	IBA	21873635
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IMP	16735691
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038156	Process	Interleukin-3-mediated signaling pathway	ISS
GO:0042590	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I	IBA	21873635
GO:0042742	Process	Defense response to bacterium	IBA	21873635
GO:0042802	Function	Identical protein binding	IDA	14967045
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0050766	Process	Positive regulation of phagocytosis	IBA	21873635
GO:0050900	Process	Leukocyte migration	TAS
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

MIM	HGNC	e!Ensembl
147139	3611	ENSG00000158869

Protein

UniProt ID

P30273

Protein name

High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon RI-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)

Protein function

Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammat

PDB

7Q5T , 8YVU , 8YWA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11628	TCR_zetazeta	21 → 51	T-cell surface glycoprotein CD3 zeta chain	Family
PF02189	ITAM	62 → 81	Immunoreceptor tyrosine-based activation motif	Motif

Sequence

MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Sphingolipid signaling pathway Phospholipase D signaling pathway Platelet activation C-type lectin receptor signaling pathway Natural killer cell mediated cytotoxicity Fc epsilon RI signaling pathway Tuberculosis Asthma		GPVI-mediated activation cascade Cell surface interactions at the vascular wall Fc epsilon receptor (FCERI) signaling Role of LAT2/NTAL/LAB on calcium mobilization FCERI mediated MAPK activation FCERI mediated Ca+2 mobilization FCERI mediated NF-kB activation Dectin-2 family Neutrophil degranulation Platelet Adhesion to exposed collagen

Show/Hide Unknown Diseases (3)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma, Childhood asthma	30929738, 31619474	ClinVar, GWAS
Eczema	Eczema		GWAS
Aggressive Periodontitis	Aggressive Periodontitis		GWAS

Show/Hide Text Mining Associations (51)

Disease Name	Relationship Type	References
Associations from Text Mining
Acne Vulgaris	Associate	31281837
Adenocarcinoma	Associate	32509861
Alzheimer Disease	Associate	35436980
Anemia Aplastic	Inhibit	22401598
Aortic Aneurysm Abdominal	Associate	34814367
Arthritis Rheumatoid	Associate	23146195
Atherosclerosis	Associate	34925641, 39702436
Autoimmune Diseases	Associate	12626537, 17692570
Breast Neoplasms	Associate	37081323
Carcinoma Renal Cell	Stimulate	29209141
Carcinoma Renal Cell	Associate	35120484
Carotid Artery Diseases	Associate	34140767
Charcot Marie Tooth disease Type 1C	Associate	38267482
Chemical and Drug Induced Liver Injury	Associate	26712042
COVID 19	Associate	34504502, 36066491, 38267482
Drug Hypersensitivity	Associate	37861500
Esophageal Neoplasms	Associate	34257539
Glomerulonephritis IGA	Associate	32894197
Hepatitis C Chronic	Associate	26712042
HIV Infections	Inhibit	20224795, 29616021
HIV Infections	Associate	33188073
Hypertension	Associate	32888289
Immune System Diseases	Associate	18378679
Immunoglobulin Light chain Amyloidosis	Associate	32922167
Kidney Diseases	Associate	33659005
Leukemia Large Granular Lymphocytic	Associate	33188073
Leukemia Lymphocytic Chronic B Cell	Associate	22664044
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23228155
Leukemia Myeloid Acute	Associate	25757160, 29286103
Liver Failure	Associate	35726350
Lupus Erythematosus Systemic	Stimulate	11352243
Lupus Erythematosus Systemic	Associate	12626537, 12847689, 17692570, 17878388, 18714041, 19018007, 19201859, 26582197
Lupus Nephritis	Associate	31638917
Lymphoma T Cell	Associate	25513989
Melanoma	Associate	33177155, 35135212
Multiple Myeloma	Inhibit	37170758
Multiple Organ Failure	Associate	34504502
Myocardial Infarction	Associate	32594092, 33847684
Nasal Polyps	Associate	36466903
Neoplasm Metastasis	Associate	36054819
Neoplasms	Associate	35120484, 36054819
Non alcoholic Fatty Liver Disease	Associate	32594092
Osteosarcoma	Associate	35078433
Platelet Storage Pool Deficiency	Associate	30545925
Pneumonia	Associate	37861500
Rhinitis Allergic	Associate	26792385
Spinal Cord Injuries	Associate	36842142, 37063890
Synovitis	Associate	35711523
T cell immunodeficiency primary	Associate	22664044
Thrombosis	Associate	30545925
Vasculitis	Associate	35246248

FCER1G (Fc epsilon receptor Ig)