Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2207
Gene name Gene Name - the full gene name approved by the HGNC.
Fc epsilon receptor Ig
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCER1G
Synonyms (NCBI Gene) Gene synonyms aliases
FCRG
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT054333 hsa-miR-1225-3p Microarray, qRT-PCR 23593351
MIRT993751 hsa-miR-2110 CLIP-seq
MIRT993752 hsa-miR-3135b CLIP-seq
MIRT993753 hsa-miR-4259 CLIP-seq
MIRT993754 hsa-miR-4271 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001798 Process Positive regulation of type IIa hypersensitivity IEA
GO:0001805 Process Positive regulation of type III hypersensitivity IEA
GO:0001812 Process Positive regulation of type I hypersensitivity IEA
GO:0002283 Process Neutrophil activation involved in immune response IBA
GO:0002283 Process Neutrophil activation involved in immune response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147139 3611 ENSG00000158869
Protein
UniProt ID P30273
Protein name High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon RI-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)
Protein function Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammat
PDB 7Q5T , 8YVU , 8YWA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11628 TCR_zetazeta 21 51 T-cell surface glycoprotein CD3 zeta chain Family
PF02189 ITAM 62 81 Immunoreceptor tyrosine-based activation motif Motif
Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ
Sequence length 86
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Sphingolipid signaling pathway
Phospholipase D signaling pathway
Platelet activation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Tuberculosis
Asthma
  GPVI-mediated activation cascade
Cell surface interactions at the vascular wall
Fc epsilon receptor (FCERI) signaling
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
FCERI mediated NF-kB activation
Dectin-2 family
Neutrophil degranulation
Platelet Adhesion to exposed collagen
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Aggressive Periodontitis Aggressive periodontitis N/A N/A GWAS
Asthma Asthma onset (childhood vs adult), Age of onset of childhood onset asthma, Asthma, Asthma (childhood onset), Atopic asthma N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acne Vulgaris Associate 31281837
Adenocarcinoma Associate 32509861
Alzheimer Disease Associate 35436980
Anemia Aplastic Inhibit 22401598
Aortic Aneurysm Abdominal Associate 34814367
Arthritis Rheumatoid Associate 23146195
Atherosclerosis Associate 34925641, 39702436
Autoimmune Diseases Associate 12626537, 17692570
Breast Neoplasms Associate 37081323
Carcinoma Renal Cell Stimulate 29209141