Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2206
Gene name Gene Name - the full gene name approved by the HGNC.
Membrane spanning 4-domains A2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MS4A2
Synonyms (NCBI Gene) Gene synonyms aliases
APY, ATOPY, FCER1B, FCERI, IGEL, IGER, IGHER
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-l
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs569108 A>G Risk-factor Missense variant, genic downstream transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017962 hsa-miR-335-5p Microarray 18185580
MIRT1160980 hsa-miR-122 CLIP-seq
MIRT1160981 hsa-miR-1234 CLIP-seq
MIRT1160982 hsa-miR-125a-3p CLIP-seq
MIRT1160983 hsa-miR-128 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
GATA2 Activation 24639354
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 1535625
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147138 7316 ENSG00000149534
Protein
UniProt ID Q01362
Protein name High affinity immunoglobulin epsilon receptor subunit beta (FcERI) (Fc epsilon receptor I beta-chain) (IgE Fc receptor subunit beta) (Membrane-spanning 4-domains subfamily A member 2)
Protein function High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranul
PDB 8YVU , 8YWA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04103 CD20 60 204 CD20-like family Family
Tissue specificity TISSUE SPECIFICITY: Found on the surface of mast cells and basophils.
Sequence
MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEF
LGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISER
RNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTE
IVVMMLFLTILGLGSAVSLTICGA
GEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSP
PIDL
Sequence length 244
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Sphingolipid signaling pathway
Phospholipase D signaling pathway
Fc epsilon RI signaling pathway
Asthma
  Fc epsilon receptor (FCERI) signaling
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
FCERI mediated NF-kB activation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 28650998
Asthma Associate 10712341, 16519819, 19862939, 20554927, 21320344, 22432035, 22533235, 24039878, 24838642, 29761786, 33277970, 38049812, 40189906
Asthma Aspirin Induced Associate 18595682
Cerebral Infarction Associate 22769019
Dermatitis Atopic 3 Associate 10712341
Drug Hypersensitivity Associate 23643722, 33277970, 36725846
Eczema Associate 33277970, 34261469
Ige Responsiveness Atopic Associate 10712341, 16519819, 24039878, 29761786, 33277970, 34261469
Inflammation Associate 19514647, 34261469
Lung Diseases Associate 20554927