Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2204
Gene name	Fc alpha receptor
Gene symbol	FCAR
Synonyms (NCBI Gene)	CD89CTB-61M7.2FcalphaRFcalphaRI
Chromosome	19
Chromosome location	19q13.42
Summary	This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eos

208

Show/Hide all (208)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019354	hsa-miR-148b-3p	Microarray	17612493
MIRT993690	hsa-miR-128	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993695	hsa-miR-3120-5p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993700	hsa-miR-3664-5p	CLIP-seq
MIRT993701	hsa-miR-3671	CLIP-seq
MIRT993702	hsa-miR-3672	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993705	hsa-miR-371-5p	CLIP-seq
MIRT993706	hsa-miR-371b-5p	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993708	hsa-miR-3926	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT993712	hsa-miR-4522	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993718	hsa-miR-548c-3p	CLIP-seq
MIRT993719	hsa-miR-548s	CLIP-seq
MIRT993690	hsa-miR-128	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993708	hsa-miR-3926	CLIP-seq
MIRT993720	hsa-miR-3929	CLIP-seq
MIRT993721	hsa-miR-4267	CLIP-seq
MIRT993722	hsa-miR-4419b	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993723	hsa-miR-4478	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT993724	hsa-miR-455-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993725	hsa-miR-485-5p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993719	hsa-miR-548s	CLIP-seq
MIRT993726	hsa-miR-550a	CLIP-seq
MIRT993727	hsa-miR-890	CLIP-seq
MIRT993728	hsa-miR-122	CLIP-seq
MIRT993729	hsa-miR-1227	CLIP-seq
MIRT993730	hsa-miR-1273e	CLIP-seq
MIRT993731	hsa-miR-130a	CLIP-seq
MIRT993732	hsa-miR-130b	CLIP-seq
MIRT993733	hsa-miR-1827	CLIP-seq
MIRT993734	hsa-miR-301a	CLIP-seq
MIRT993735	hsa-miR-301b	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993736	hsa-miR-3135b	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993737	hsa-miR-3192	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993738	hsa-miR-3652	CLIP-seq
MIRT993739	hsa-miR-3665	CLIP-seq
MIRT993740	hsa-miR-3666	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993708	hsa-miR-3926	CLIP-seq
MIRT993741	hsa-miR-4252	CLIP-seq
MIRT993742	hsa-miR-4295	CLIP-seq
MIRT993743	hsa-miR-4430	CLIP-seq
MIRT993744	hsa-miR-454	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993745	hsa-miR-4736	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993746	hsa-miR-4793-3p	CLIP-seq
MIRT993747	hsa-miR-490-3p	CLIP-seq
MIRT993748	hsa-miR-508-5p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993719	hsa-miR-548s	CLIP-seq
MIRT993749	hsa-miR-766	CLIP-seq
MIRT993750	hsa-miR-940	CLIP-seq
MIRT2228828	hsa-miR-1262	CLIP-seq
MIRT993690	hsa-miR-128	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993708	hsa-miR-3926	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT2228829	hsa-miR-4701-3p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993746	hsa-miR-4793-3p	CLIP-seq
MIRT993748	hsa-miR-508-5p	CLIP-seq
MIRT2228830	hsa-miR-542-3p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993719	hsa-miR-548s	CLIP-seq
MIRT2228831	hsa-miR-661	CLIP-seq
MIRT993749	hsa-miR-766	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT2449582	hsa-miR-3675-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT2449583	hsa-miR-4684-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993718	hsa-miR-548c-3p	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993695	hsa-miR-3120-5p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT2532379	hsa-miR-3613-3p	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT993700	hsa-miR-3664-5p	CLIP-seq
MIRT993701	hsa-miR-3671	CLIP-seq
MIRT993702	hsa-miR-3672	CLIP-seq
MIRT2449582	hsa-miR-3675-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993705	hsa-miR-371-5p	CLIP-seq
MIRT993706	hsa-miR-371b-5p	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993709	hsa-miR-4433	CLIP-seq
MIRT993710	hsa-miR-4459	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT993712	hsa-miR-4522	CLIP-seq
MIRT2449583	hsa-miR-4684-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993715	hsa-miR-4768-3p	CLIP-seq
MIRT993716	hsa-miR-4786-5p	CLIP-seq
MIRT993717	hsa-miR-544b	CLIP-seq
MIRT993718	hsa-miR-548c-3p	CLIP-seq
MIRT2532380	hsa-miR-548n	CLIP-seq
MIRT993691	hsa-miR-1293	CLIP-seq
MIRT993692	hsa-miR-216a	CLIP-seq
MIRT993693	hsa-miR-216b	CLIP-seq
MIRT993694	hsa-miR-3065-3p	CLIP-seq
MIRT993696	hsa-miR-3122	CLIP-seq
MIRT993697	hsa-miR-3165	CLIP-seq
MIRT993698	hsa-miR-3622a-3p	CLIP-seq
MIRT993699	hsa-miR-3622b-3p	CLIP-seq
MIRT2449582	hsa-miR-3675-3p	CLIP-seq
MIRT993703	hsa-miR-3689a-3p	CLIP-seq
MIRT993704	hsa-miR-3689c	CLIP-seq
MIRT993707	hsa-miR-3913-5p	CLIP-seq
MIRT993711	hsa-miR-4483	CLIP-seq
MIRT2449583	hsa-miR-4684-5p	CLIP-seq
MIRT993713	hsa-miR-4728-5p	CLIP-seq
MIRT993714	hsa-miR-4761-5p	CLIP-seq
MIRT993718	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002446	Process	Neutrophil mediated immunity	IDA	25339672
GO:0002764	Process	Immune response-regulating signaling pathway	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25339672
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2258698
GO:0006955	Process	Immune response	TAS	10835685
GO:0016020	Component	Membrane	IEA
GO:0019766	Function	IgA receptor activity	IDA	25339672
GO:0019862	Function	IgA binding	IDA	25339672
GO:0019862	Function	IgA binding	IEA
GO:0033031	Process	Positive regulation of neutrophil apoptotic process	IDA	25339672
GO:0035457	Process	Cellular response to interferon-alpha	IDA	25339672
GO:0035579	Component	Specific granule membrane	TAS
GO:0038093	Process	Fc receptor signaling pathway	IDA	25339672
GO:0042119	Process	Neutrophil activation	IDA	25339672
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	25339672
GO:0071346	Process	Cellular response to type II interferon	IDA	25339672
GO:0071354	Process	Cellular response to interleukin-6	IDA	25339672
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	25339672
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	25339672
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

MIM	HGNC	e!Ensembl
147045	3608	ENSG00000186431

P24071

Protein name

Immunoglobulin alpha Fc receptor (IgA Fc receptor) (CD antigen CD89)

Protein function

Binds to the Fc region of immunoglobulins alpha. Mediates several functions including cytokine production.

PDB

1OVZ , 1OW0 , 1UCT , 8SKU

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Isoform A.1, isoform A.2 and isoform A.3 are differentially expressed between blood and mucosal myeloid cells. Isoform A.1, isoform A.2 and isoform A.3 are expressed in monocytes. Isoform A.1 and isoform A.2 are expressed in alveolar m

Sequence

MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQL
MIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVT
GLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSL
GPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVA
LLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK

Sequence length

287

Interactions

View interactions

	KEGG		Reactome
	Phagosome Staphylococcus aureus infection		Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRANULOMATOSIS WITH POLYANGIITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
beta Thalassemia	Associate	17178667, 31399060, 32278313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Associate	28736835	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Associate	29025244	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Associate	26812355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	2990780	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	37302069	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Stimulate	2990780	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Associate	29025244	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Associate	16928613, 20811333, 21116273, 8196290, 9367406, 9573548	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Inhibit	32085673	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Associate	22147912	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatous Disease Chronic	Associate	14688376	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	22147912	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	12560105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	2990780, 36232432	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Inhibit	40294794	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Associate	38064228	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	21116273	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Associate	21116273	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Associate	39261750	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	15559377	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	10820252	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Associate	30216441	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pneumonia	Associate	12560105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	39780163	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Associate	17178667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	35909123	★★★★★ ★☆☆☆☆ Found in Text Mining only

FCAR (Fc alpha receptor)