MRPL21 (mitochondrial ribosomal protein L21)

Gene

• Entrez ID: 219927
• Gene name: Mitochondrial ribosomal protein L21
• Gene symbol: MRPL21
• Synonyms (NCBI Gene): L21mt, MRP-L21, bL21m
• Chromosome: 11
• Chromosome location: 11q13.3
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT032023	hsa-miR-16-5p	Proteomics	18668040
MIRT039707	hsa-miR-615-3p	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005762	Component	Mitochondrial large ribosomal subunit	IBA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	25278503, 28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 611834
• HGNC: 14479
• e!Ensembl: ENSG00000197345

Protein

• UniProt ID: Q7Z2W9
• Protein name: Large ribosomal subunit protein bL21m (39S ribosomal protein L21, mitochondrial) (L21mt) (MRP-L21)
• PDB: 3J7Y, 3J9M, 5OOL, 5OOM, 6I9R, 6NU2, 6NU3, 6VLZ, 6VMI, 6ZM5, 6ZM6, 6ZS9, 6ZSA, 6ZSB, 6ZSC, 6ZSD, 6ZSE, 6ZSG, 7A5F, 7A5G, 7A5H, 7A5I, 7A5J, 7A5K, 7L08, 7L20, 7O9K, 7O9M, 7ODR, 7ODS, 7ODT, 7OF0, 7OF2, 7OF3, 7OF4, 7OF5, 7OF6, 7OF7, 7OG4, 7OI6, 7OI7, 7OI8, 7OI9, 7OIA, 7OIB, 7OIC, 7OID, 7OIE, 7PD3, 7PO4, 7QH6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00829	Ribosomal_L21p	95 → 198	Ribosomal prokaryotic L21 protein	Family

• Sequence:

  MAASSLTVTLGRLASACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPP
  WPEVVLPDPVEETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNEL
  DLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNF
  KKKRIVTTPQTVLRINSIEIAPCLL

• Sequence length: 205

Pathways

KEGG:

Ribosome

Reactome:

Mitochondrial translation elongation
Mitochondrial translation termination

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinogenesis	Associate	19034969	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	38181584	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	37185598	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	19034969	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19034969	★☆☆☆☆ Found in Text Mining only