Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
219771
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin Y
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCNY
Synonyms (NCBI Gene) Gene synonyms aliases
C10orf9, CBCP1, CCNX, CFP1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024653 hsa-miR-215-5p Microarray 19074876
MIRT026358 hsa-miR-192-5p Microarray 19074876
MIRT032307 hsa-let-7b-5p Proteomics 18668040
MIRT041426 hsa-miR-193b-3p CLASH 23622248
MIRT038847 hsa-miR-93-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle IDA 20059949
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IEA
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IPI 19524571
GO:0000308 Component Cytoplasmic cyclin-dependent protein kinase holoenzyme complex IBA
GO:0000308 Component Cytoplasmic cyclin-dependent protein kinase holoenzyme complex IDA 19524571, 20059949
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612786 23354 ENSG00000108100
Protein
UniProt ID Q8ND76
Protein name Cyclin-Y (Cyc-Y) (Cyclin box protein 1) (Cyclin fold protein 1) (cyclin-X)
Protein function Positive regulatory subunit of the cyclin-dependent kinases CDK14/PFTK1 and CDK16. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by recruiting CDK14/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 143 265 Cyclin, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:18060517}.
Sequence
MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPS
DHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTI
KCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFS
AAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQI
LKDITVEDMNELERQFLELLQFNIN
VPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAH
KLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS
Sequence length 341
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Eosinophilia Eosinophilic esophagitis N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease, Inflammatory bowel disease (MTAG) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 28381877
Carcinoma Renal Cell Associate 29633253
Colitis Ulcerative Associate 21830272
Colonic Diseases Associate 21830272
Crohn Disease Associate 21830272
Kidney Neoplasms Associate 30411496
Malformations of Cortical Development Group I Associate 28381165
Neoplasms Associate 28381877