Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
219770
Gene name Gene Name - the full gene name approved by the HGNC.
Gap junction protein delta 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GJD4
Synonyms (NCBI Gene) Gene synonyms aliases
CX40.1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
Connexins, such as GJD4, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin s
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1020023 hsa-miR-4252 CLIP-seq
MIRT1020024 hsa-miR-4419a CLIP-seq
MIRT1020025 hsa-miR-4459 CLIP-seq
MIRT1020026 hsa-miR-4510 CLIP-seq
MIRT1020027 hsa-miR-4779 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005243 Function Gap junction channel activity IBA 21873635
GO:0005922 Component Connexin complex IBA 21873635
GO:0007267 Process Cell-cell signaling IBA 21873635
GO:0016021 Component Integral component of membrane IEA
GO:0055085 Process Transmembrane transport IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611922 23296 ENSG00000177291
Protein
UniProt ID Q96KN9
Protein name Gap junction delta-4 protein (Connexin-40.1) (Cx40.1)
Protein function One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
PDB 8GN7 , 8GN8 , 8GNB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00029 Connexin 4 221 Connexin Family
Tissue specificity TISSUE SPECIFICITY: Expressed in pancreas, kidney, skeletal muscle, liver, placenta, and heart. {ECO:0000269|PubMed:12881038}.
Sequence
MEGVDLLGFLIITLNCNVTMVGKLWFVLTMLLRMLVIVLAGRPVYQDEQERFVCNTLQPG
CANVCYDVFSPVSHLRFWLIQGVCVLLPSAVFSVYVLHRGATLAALGPRRCPDPREPASG
QRRCPRPFGERGGLQVPDFSAGYIIHLLLRTLLEAAFGALHYFLFGFLAPKKFPCTRPPC
TGVVDCYVSRPTEKSLLMLFLWAVSALSFLLGLADLVCSLR
RRMRRRPGPPTSPSIRKQS
GASGHAEGRRTDEEGGREEEGAPAPPGARAGGEGAGSPRRTSRVSGHTKIPDEDESEVTS
SASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSGAP
HLRARKSEWV
Sequence length 370
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Gap junction assembly
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Associations from Text Mining
Disease Name Relationship Type References
Dysferlinopathy Associate 27229680