Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	219623
Gene name	Transmembrane protein 26
Gene symbol	TMEM26
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q21.2
Summary	This gene encodes a protein containing multiple transmembrane helices. It is a selective surface protein marker of brite/beige adipocytes, which may coexist with classical brown adipocytes in brown adipose tissue. Alternative splicing of this gene results

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments
MIRT1436189	hsa-let-7a	CLIP-seq
MIRT1436190	hsa-let-7b	CLIP-seq
MIRT1436191	hsa-let-7c	CLIP-seq
MIRT1436192	hsa-let-7d	CLIP-seq
MIRT1436193	hsa-let-7e	CLIP-seq
MIRT1436194	hsa-let-7f	CLIP-seq
MIRT1436195	hsa-let-7g	CLIP-seq
MIRT1436196	hsa-let-7i	CLIP-seq
MIRT1436197	hsa-miR-1275	CLIP-seq
MIRT1436198	hsa-miR-128	CLIP-seq
MIRT1436199	hsa-miR-1293	CLIP-seq
MIRT1436200	hsa-miR-1294	CLIP-seq
MIRT1436201	hsa-miR-202	CLIP-seq
MIRT1436202	hsa-miR-299-5p	CLIP-seq
MIRT1436203	hsa-miR-29a	CLIP-seq
MIRT1436204	hsa-miR-29b	CLIP-seq
MIRT1436205	hsa-miR-29c	CLIP-seq
MIRT1436206	hsa-miR-3065-3p	CLIP-seq
MIRT1436207	hsa-miR-3147	CLIP-seq
MIRT1436208	hsa-miR-3156-5p	CLIP-seq
MIRT1436209	hsa-miR-3160-3p	CLIP-seq
MIRT1436210	hsa-miR-3187-3p	CLIP-seq
MIRT1436211	hsa-miR-3658	CLIP-seq
MIRT1436212	hsa-miR-3671	CLIP-seq
MIRT1436213	hsa-miR-3909	CLIP-seq
MIRT1436214	hsa-miR-3921	CLIP-seq
MIRT1436215	hsa-miR-4251	CLIP-seq
MIRT1436216	hsa-miR-4275	CLIP-seq
MIRT1436217	hsa-miR-4329	CLIP-seq
MIRT1436218	hsa-miR-4424	CLIP-seq
MIRT1436219	hsa-miR-4425	CLIP-seq
MIRT1436220	hsa-miR-4435	CLIP-seq
MIRT1436221	hsa-miR-4446-3p	CLIP-seq
MIRT1436222	hsa-miR-4458	CLIP-seq
MIRT1436223	hsa-miR-4483	CLIP-seq
MIRT1436224	hsa-miR-4500	CLIP-seq
MIRT1436225	hsa-miR-4529-5p	CLIP-seq
MIRT1436226	hsa-miR-4633-3p	CLIP-seq
MIRT1436227	hsa-miR-4653-5p	CLIP-seq
MIRT1436228	hsa-miR-4659a-3p	CLIP-seq
MIRT1436229	hsa-miR-4659b-3p	CLIP-seq
MIRT1436230	hsa-miR-4665-5p	CLIP-seq
MIRT1436231	hsa-miR-4675	CLIP-seq
MIRT1436232	hsa-miR-4687-3p	CLIP-seq
MIRT1436233	hsa-miR-4690-3p	CLIP-seq
MIRT1436234	hsa-miR-4693-3p	CLIP-seq
MIRT1436235	hsa-miR-4701-5p	CLIP-seq
MIRT1436236	hsa-miR-4705	CLIP-seq
MIRT1436237	hsa-miR-4723-5p	CLIP-seq
MIRT1436238	hsa-miR-4728-5p	CLIP-seq
MIRT1436239	hsa-miR-4741	CLIP-seq
MIRT1436240	hsa-miR-4775	CLIP-seq
MIRT1436241	hsa-miR-4781-3p	CLIP-seq
MIRT1436242	hsa-miR-548s	CLIP-seq
MIRT1436243	hsa-miR-588	CLIP-seq
MIRT1436244	hsa-miR-590-3p	CLIP-seq
MIRT1436245	hsa-miR-892a	CLIP-seq
MIRT1436246	hsa-miR-98	CLIP-seq
MIRT2130724	hsa-miR-1264	CLIP-seq
MIRT2130725	hsa-miR-1343	CLIP-seq
MIRT2130726	hsa-miR-155	CLIP-seq
MIRT2130727	hsa-miR-3074-5p	CLIP-seq
MIRT2130728	hsa-miR-330-3p	CLIP-seq
MIRT2130729	hsa-miR-3646	CLIP-seq
MIRT2130730	hsa-miR-4426	CLIP-seq
MIRT2130731	hsa-miR-4493	CLIP-seq
MIRT2130732	hsa-miR-4646-5p	CLIP-seq
MIRT2130733	hsa-miR-4647	CLIP-seq
MIRT2130734	hsa-miR-4662b	CLIP-seq
MIRT2130735	hsa-miR-4716-5p	CLIP-seq
MIRT2130736	hsa-miR-4747-5p	CLIP-seq
MIRT2130737	hsa-miR-4766-5p	CLIP-seq
MIRT2130738	hsa-miR-592	CLIP-seq
MIRT2130739	hsa-miR-597	CLIP-seq
MIRT2130740	hsa-miR-616	CLIP-seq
MIRT2130741	hsa-miR-661	CLIP-seq
MIRT2130725	hsa-miR-1343	CLIP-seq
MIRT2352064	hsa-miR-182	CLIP-seq
MIRT2130727	hsa-miR-3074-5p	CLIP-seq
MIRT1436212	hsa-miR-3671	CLIP-seq
MIRT2352065	hsa-miR-4272	CLIP-seq
MIRT2352066	hsa-miR-4420	CLIP-seq
MIRT1436203	hsa-miR-29a	CLIP-seq
MIRT1436204	hsa-miR-29b	CLIP-seq
MIRT1436205	hsa-miR-29c	CLIP-seq
MIRT1436206	hsa-miR-3065-3p	CLIP-seq
MIRT1436212	hsa-miR-3671	CLIP-seq
MIRT1436212	hsa-miR-3671	CLIP-seq
MIRT1436228	hsa-miR-4659a-3p	CLIP-seq
MIRT1436229	hsa-miR-4659b-3p	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
617803	28550	ENSG00000196932

Q6ZUK4

Protein name

Transmembrane protein 26

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09772	Tmem26	3 → 303	Transmembrane protein 26	Family

Sequence

MEGLVFLNALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGR
GYKWFSPAIFLYLISIVPSLWLLELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTS
RADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIGGGITRDQLSQLLLM
FVGTAADILEFTSETLEEQNVRNSPALVYAILVIWTWSMLQFPLDLAVQNVVCPVSVTER
GFPSLFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFKVINQMLVFFAAKNFLVVVLQ
LYRLVVLALAVRASLRSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVT
SDDSHHTP

Sequence length

368

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	27224909	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Inhibit	27224909	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	26756119, 31714428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Injury	Associate	22986903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	27224909	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	22986903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	22529986	★★★★★ ★☆☆☆☆ Found in Text Mining only

TMEM26 (transmembrane protein 26)