Gene Gene information from NCBI Gene database.
Entrez ID 219293
Gene name ATPase family AAA domain containing 3C
Gene symbol ATAD3C
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p36.33
miRNA miRNA information provided by mirtarbase database.
340
miRTarBase ID miRNA Experiments Reference
MIRT041557 hsa-miR-193b-3p CLASH 23622248
MIRT645037 hsa-miR-6890-3p HITS-CLIP 23824327
MIRT645036 hsa-miR-3937 HITS-CLIP 23824327
MIRT662634 hsa-miR-1304-3p HITS-CLIP 23824327
MIRT633552 hsa-miR-2116-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0005524 Function ATP binding IEA
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA
GO:0007005 Process Mitochondrion organization IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617227 32151 ENSG00000215915
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T2N8
Protein name ATPase family AAA domain-containing protein 3C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12037 DUF3523 25 110 Domain of unknown function (DUF3523) Family
PF00004 AAA 173 300 ATPase family associated with various cellular activities (AAA) Domain
Sequence
MSKDALNLAQMQEQTLQLEQQSKLKQLVNEDLRKQEESVQKHHQTFLESIRAAGTLFGEG
FRAFVTDRDKVTATVAGLTLLAVGVYSAKNATAVTGRYIEARLGKPSLVR
ETSRITVLEA
LRHPIQQVSRRLLSRPQDVLEGVVLSPSLEARVRDIAIMTRNIKKNRGLYRHILLYGPPG
TGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADA
FLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLILASCHPEQFDWAINACIDVMVHFDL

PGQEERARLVRMYLNEYVLKPATEGKRRLKLAQFDYGRKCLEIARLTEGMSCRKIAQLAV
SWQATAYASKDGVLTEAMMDACVQDFVQQHQQMMRWLKGERPGPEDEQPSS
Sequence length 411
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
1P36.33 DUPLICATION SYNDROME Disgenet, Orphanet
Disgenet, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Asthma Associate 35858526
★☆☆☆☆
Found in Text Mining only
Ataxia Associate 28549128
★☆☆☆☆
Found in Text Mining only
Brain Diseases Associate 28549128
★☆☆☆☆
Found in Text Mining only
Cerebellar Diseases Associate 28549128
★☆☆☆☆
Found in Text Mining only
Dystonia Associate 28549128
★☆☆☆☆
Found in Text Mining only