Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2191
Gene name Gene Name - the full gene name approved by the HGNC.	Fibroblast activation protein alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FAP
Synonyms (NCBI Gene) Gene synonyms aliases	DPPIV, FAPA, FAPalpha, SIMP
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT756324	hsa-miR-329-5p	Luciferase reporter assay, Western blotting, qRT-PCR	38459511
MIRT1548582	hsa-miR-4303	CLIP-seq
MIRT1548583	hsa-miR-4682	CLIP-seq
MIRT2227036	hsa-miR-1911	CLIP-seq
MIRT2227037	hsa-miR-27a	CLIP-seq
MIRT2227038	hsa-miR-27b	CLIP-seq
MIRT2227039	hsa-miR-4778-3p	CLIP-seq
MIRT2227040	hsa-miR-4797-5p	CLIP-seq
MIRT2227041	hsa-miR-513a-5p	CLIP-seq
MIRT2530843	hsa-miR-1236	CLIP-seq
MIRT2227036	hsa-miR-1911	CLIP-seq
MIRT2530844	hsa-miR-204	CLIP-seq
MIRT2530845	hsa-miR-211	CLIP-seq
MIRT2227037	hsa-miR-27a	CLIP-seq
MIRT2227038	hsa-miR-27b	CLIP-seq
MIRT2530846	hsa-miR-30a	CLIP-seq
MIRT2530847	hsa-miR-30b	CLIP-seq
MIRT2530848	hsa-miR-30c	CLIP-seq
MIRT2530849	hsa-miR-30d	CLIP-seq
MIRT2530850	hsa-miR-30e	CLIP-seq
MIRT2530851	hsa-miR-338-5p	CLIP-seq
MIRT2530852	hsa-miR-3545-3p	CLIP-seq
MIRT2530853	hsa-miR-4287	CLIP-seq
MIRT1548582	hsa-miR-4303	CLIP-seq
MIRT2530854	hsa-miR-4327	CLIP-seq
MIRT2530855	hsa-miR-4438	CLIP-seq
MIRT2530856	hsa-miR-4453	CLIP-seq
MIRT2530857	hsa-miR-4495	CLIP-seq
MIRT2530858	hsa-miR-4538	CLIP-seq
MIRT1548583	hsa-miR-4682	CLIP-seq
MIRT2530859	hsa-miR-4685-3p	CLIP-seq
MIRT2530860	hsa-miR-4753-3p	CLIP-seq
MIRT2530861	hsa-miR-4768-5p	CLIP-seq
MIRT2530862	hsa-miR-4773	CLIP-seq
MIRT2227039	hsa-miR-4778-3p	CLIP-seq
MIRT2227040	hsa-miR-4797-5p	CLIP-seq
MIRT2530863	hsa-miR-5095	CLIP-seq
MIRT2227041	hsa-miR-513a-5p	CLIP-seq
MIRT2530854	hsa-miR-4327	CLIP-seq
MIRT2530855	hsa-miR-4438	CLIP-seq
MIRT2530863	hsa-miR-5095	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
EGR1	Activation	20515787
EGR1	Repression	20515787

Show/Hide all(63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0002020	Function	Protease binding	IPI	17317851
GO:0004175	Function	Endopeptidase activity	IDA	17317851
GO:0004252	Function	Serine-type endopeptidase activity	IDA	10593948
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005178	Function	Integrin binding	IPI	10455171
GO:0005515	Function	Protein binding	IPI	16651416, 21314817
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	17317851
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10593948
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	10455171
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	10455171
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	IMP	9065413
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0008233	Function	Peptidase activity	IDA	9688278, 10455171
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IDA	16651416
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IMP	9065413
GO:0008236	Function	Serine-type peptidase activity	NAS	7911242
GO:0008239	Function	Dipeptidyl-peptidase activity	IBA
GO:0008239	Function	Dipeptidyl-peptidase activity	IDA	10593948
GO:0008239	Function	Dipeptidyl-peptidase activity	IEA
GO:0008239	Function	Dipeptidyl-peptidase activity	NAS	7911242
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0010710	Process	Regulation of collagen catabolic process	IDA	10455171
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	IDA	16651416
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9065413
GO:0016787	Function	Hydrolase activity	IEA
GO:0030027	Component	Lamellipodium	IDA	9065413, 16651416
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0032587	Component	Ruffle membrane	NAS	10455171
GO:0042802	Function	Identical protein binding	IPI	9065413
GO:0042803	Function	Protein homodimerization activity	IDA	10455171
GO:0042995	Component	Cell projection	IEA
GO:0043542	Process	Endothelial cell migration	IDA	16651416
GO:0045177	Component	Apical part of cell	IEA
GO:0045178	Component	Basal part of cell	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IDA	10593948
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0051917	Process	Regulation of fibrinolysis	IC	17317851
GO:0060244	Process	Negative regulation of cell proliferation involved in contact inhibition	IEA
GO:0060244	Process	Negative regulation of cell proliferation involved in contact inhibition	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0097325	Process	Melanocyte proliferation	IEA
GO:0097325	Process	Melanocyte proliferation	ISS
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	ISS
GO:1902362	Process	Melanocyte apoptotic process	IEA
GO:1902362	Process	Melanocyte apoptotic process	ISS
GO:1903054	Process	Negative regulation of extracellular matrix organization	IDA	10455171
GO:1905368	Component	Peptidase complex	IMP	9065413

MIM	HGNC	e!Ensembl
600403	3590	ENSG00000078098

Protein

UniProt ID

Q12884

Protein name

Prolyl endopeptidase FAP (EC 3.4.21.26) (170 kDa melanoma membrane-bound gelatinase) (Dipeptidyl peptidase FAP) (EC 3.4.14.5) (Fibroblast activation protein alpha) (FAPalpha) (Gelatine degradation protease FAP) (EC 3.4.21.-) (Integral membrane serine prot

Protein function

Cell surface glycoprotein serine protease that participates in extracellular matrix degradation and involved in many cellular processes including tissue remodeling, fibrosis, wound healing, inflammation and tumor growth. Both plasma membrane and

PDB

1Z68 , 6Y0F , 9DVQ , 9DVR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00930	DPPIV_N	106 → 473	Dipeptidyl peptidase IV (DPP IV) N-terminal region	Family
PF00326	Peptidase_S9	553 → 759	Prolyl oligopeptidase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in adipose tissue. Expressed in the dermal fibroblasts in the fetal skin. Expressed in the granulation tissue of healing wounds and on reactive stromal fibroblast in epithelial cancers. Expressed in activated fibroblast-like

Sequence

MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPN
WISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSK
LWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYG
DEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVT
DERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYD
AISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQ
ITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD

Sequence length

760

Interactions

View interactions

Show/Hide Unknown Diseases (9)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Diabetes	Type 1 diabetes	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS
Vitiligo	Vitiligo	N/A	N/A	GWAS

Show/Hide Text Mining Associations (107)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Coronary Syndrome	Associate	38614364
Adenocarcinoma	Associate	20080664, 32428869, 33706022
Adenocarcinoma of Lung	Associate	40453096
Aortic Diseases	Stimulate	21292680
Arthritis	Associate	21292680, 37325617
Arthritis Psoriatic	Associate	17105646
Arthritis Rheumatoid	Associate	17105646, 34134455, 34450633
Arthritis Rheumatoid	Stimulate	28793332
Atherosclerosis	Associate	37325617
Brain Neoplasms	Associate	34050405
Breast Neoplasms	Associate	22067528, 23555181, 24074532, 24885257, 26044562, 28383825, 29115573, 34651665, 36838669, 37862167, 7911242
Carcinogenesis	Associate	12542520, 36838669, 37490719
Carcinoma Basal Cell	Associate	28987144
Carcinoma Hepatocellular	Associate	25126747, 32311840, 35186170, 37325617
Carcinoma Intraductal Noninfiltrating	Associate	22067528
Carcinoma Non Small Cell Lung	Associate	33706022, 35818720, 35951090, 37919739
Carcinoma Pancreatic Ductal	Associate	22371645, 26330349
Carcinoma Renal Cell	Associate	28033421
Carcinoma Squamous Cell	Associate	29115573
Cardiovascular Diseases	Associate	38614364
Cholangiocarcinoma	Associate	38017374, 40676676
Chondroblastoma	Associate	19817894
Colonic Neoplasms	Associate	31612481
Colorectal Neoplasms	Associate	21356388, 22674411, 23298232, 23328994, 28412748, 31045759, 32428869, 35296803, 35365629, 35870973, 35999641, 36838669, 37614665
Colorectal Neoplasms	Stimulate	30355650
Common Variable Immunodeficiency	Associate	39373788
Corneal Endothelial Cell Loss	Associate	18447899
Coronary Aneurysm	Stimulate	21292680
COVID 19	Associate	37839656
Crohn Disease	Associate	33831854
Death	Inhibit	38614364
Dental Plaque	Associate	21292680
Desmoid disease hereditary	Associate	19817894
Dupuytren Contracture	Associate	34274346
Esophageal Squamous Cell Carcinoma	Associate	18981721, 28735527, 30683902
Fibroma Ossifying	Associate	19817894
Fibromatosis Aggressive	Associate	24402778
Fibrosis	Associate	11012666, 37325617, 38297310
Fibrous Dysplasia of Bone	Associate	39273006
Gastrointestinal Neoplasms	Associate	37325617
Giant Cell Arteritis	Associate	40084998
Glioblastoma	Associate	28452380, 36382346
Glioblastoma	Stimulate	33494271
Glioma	Associate	20646316, 33494271, 37864148
Glioma	Stimulate	36382346
Head and Neck Neoplasms	Associate	39619326
Heart Failure	Associate	37390254, 38297310
Hematologic Neoplasms	Associate	31189721, 34049984
Histiocytoma Malignant Fibrous	Stimulate	19817894
Hodgkin Disease	Stimulate	34049984
Inflammation	Stimulate	21292680, 26163388
Inflammation	Associate	37734836
Leukemia Myeloid Acute	Associate	33416165
Liver Cirrhosis	Associate	24034420
Lung Neoplasms	Associate	29115573
Lupus Erythematosus Systemic	Inhibit	17469140
Lymphatic Metastasis	Stimulate	25775399
Lymphatic Metastasis	Associate	28033421, 29134462, 30683902, 32428869, 33057927, 34050405, 39477498
Lymphoma	Associate	34049984
Lymphoma Non Hodgkin	Associate	34049984
Lymphoma T Cell	Associate	31885005
Melanoma	Stimulate	12542520, 24727589
Melanoma	Associate	32328671, 35538545, 9065413, 9247085
Melanoma Cutaneous Malignant	Associate	12542520
Mesothelioma Malignant	Associate	23259649
Mouth Neoplasms	Associate	29026005
Multiple Myeloma	Associate	25046247, 31885005
Muscular Diseases	Associate	37773216
Mycosis Fungoides	Stimulate	33941102
Neoplasm Invasiveness	Associate	24727589
Neoplasm Metastasis	Associate	12542520, 19817894, 25046247, 25775399, 27881889, 28033421, 29134462, 32428869, 34740953, 34874125, 35186170, 36495325, 37862167
Neoplasms	Associate	11012666, 11248693, 12542520, 16223769, 20646316, 21292680, 21356388, 21622624, 22067528, 22371645, 22674411, 23298232, 23328994, 23555181, 24074532 View all (74 more)
Neoplasms	Stimulate	25046247, 28735527, 30744595, 30922247, 34857655, 37284741, 37351329, 39930439
Neoplasms Glandular and Epithelial	Associate	34049984
Neoplasms Squamous Cell	Associate	35951090
Non Muscle Invasive Bladder Neoplasms	Associate	34525114
Obesity	Associate	31455871
Osteoarthritis	Associate	37390254, 39213112
Osteoporosis	Associate	39213112
Osteosarcoma	Associate	19817894
Ovarian Neoplasms	Associate	30448260, 32434219, 33109151, 34740953, 36494579, 39914230
Pancreatic Neoplasms	Associate	22371645, 31706267, 36051919, 36838669, 37973185
Peritonitis	Associate	35296803, 36632455
Polyposis Syndrome Hereditary Mixed 1	Associate	32428869
Prostatic Neoplasms	Associate	33148078, 34226953, 34854061, 35052475, 36874403, 38483933, 39477498, 39595976, 39629134
Prostatic Neoplasms Castration Resistant	Stimulate	34226953
Prostatic Neoplasms Castration Resistant	Associate	35052475, 37729607, 39477498
Pulmonary Disease Chronic Obstructive	Associate	37325617
Recurrence	Associate	36495325
Respiratory Tract Infections	Associate	36598731
Rotator Cuff Injuries	Associate	34779676
Sarcoma	Associate	33931468, 34018010, 7911242
Scleroderma Systemic	Associate	34884484
Soft Tissue Neoplasms	Associate	19817894
Solitary Fibrous Tumors	Associate	38176718
Squamous Cell Carcinoma of Head and Neck	Associate	30226546, 34050405, 37351329
Stomach Neoplasms	Stimulate	20529313
Stomach Neoplasms	Associate	24615523, 29134462, 35328635, 36401232, 36632455, 36650362, 37277751, 37304872, 37325617
Tarlov Cysts	Associate	22371645
Tertiary Lymphoid Structures	Associate	28033421
Thyroid Cancer Papillary	Associate	26715280
Thyroid Neoplasms	Associate	36495325
Triple Negative Breast Neoplasms	Associate	37963845
Urethral Neoplasms	Associate	35325283
Urinary Bladder Neoplasms	Associate	31937798, 34298868, 37461061
Vitreoretinopathy Proliferative	Associate	20528783
Weight Loss	Inhibit	31455871

FAP (fibroblast activation protein alpha)