Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2185
Gene name Gene Name - the full gene name approved by the HGNC.	Protein tyrosine kinase 2 beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PTK2B
Synonyms (NCBI Gene) Gene synonyms aliases	CADTK, CAKB, FADK2, FAK2, PKB, PTK, PYK2, RAFTK
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuro

Show/Hide all(181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006963	hsa-miR-23b-3p	Immunoblot	22745829
MIRT018928	hsa-miR-335-5p	Microarray	18185580
MIRT438433	hsa-miR-517a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438432	hsa-miR-517c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438433	hsa-miR-517a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT438432	hsa-miR-517c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23142219
MIRT716875	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT716874	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT716873	hsa-miR-940	HITS-CLIP	19536157
MIRT716871	hsa-miR-4514	HITS-CLIP	19536157
MIRT716872	hsa-miR-4692	HITS-CLIP	19536157
MIRT716870	hsa-miR-3665	HITS-CLIP	19536157
MIRT716869	hsa-miR-4736	HITS-CLIP	19536157
MIRT006963	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28262617
MIRT006963	hsa-miR-23b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28262617
MIRT716875	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT716874	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT716873	hsa-miR-940	HITS-CLIP	19536157
MIRT716871	hsa-miR-4514	HITS-CLIP	19536157
MIRT716872	hsa-miR-4692	HITS-CLIP	19536157
MIRT716870	hsa-miR-3665	HITS-CLIP	19536157
MIRT716869	hsa-miR-4736	HITS-CLIP	19536157
MIRT1273554	hsa-miR-3189-5p	CLIP-seq
MIRT1273555	hsa-miR-3664-3p	CLIP-seq
MIRT1273556	hsa-miR-4433	CLIP-seq
MIRT1273557	hsa-miR-4459	CLIP-seq
MIRT1273558	hsa-miR-4469	CLIP-seq
MIRT1273559	hsa-miR-4726-3p	CLIP-seq
MIRT1273560	hsa-miR-4758-3p	CLIP-seq
MIRT1273561	hsa-miR-4768-3p	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT1273563	hsa-miR-548a-5p	CLIP-seq
MIRT1273564	hsa-miR-548ab	CLIP-seq
MIRT1273565	hsa-miR-548ak	CLIP-seq
MIRT1273566	hsa-miR-548b-5p	CLIP-seq
MIRT1273567	hsa-miR-548c-5p	CLIP-seq
MIRT1273568	hsa-miR-548d-5p	CLIP-seq
MIRT1273569	hsa-miR-548h	CLIP-seq
MIRT1273570	hsa-miR-548i	CLIP-seq
MIRT1273571	hsa-miR-548j	CLIP-seq
MIRT1273572	hsa-miR-548w	CLIP-seq
MIRT1273573	hsa-miR-548y	CLIP-seq
MIRT1273574	hsa-miR-559	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2080456	hsa-miR-4651	CLIP-seq
MIRT2080457	hsa-miR-4659a-5p	CLIP-seq
MIRT2080458	hsa-miR-4659b-5p	CLIP-seq
MIRT2080459	hsa-miR-4722-3p	CLIP-seq
MIRT2080460	hsa-miR-4763-5p	CLIP-seq
MIRT2080461	hsa-miR-4769-3p	CLIP-seq
MIRT2080462	hsa-miR-491-5p	CLIP-seq
MIRT2080463	hsa-miR-517a	CLIP-seq
MIRT2080464	hsa-miR-517b	CLIP-seq
MIRT2080465	hsa-miR-517c	CLIP-seq
MIRT2080466	hsa-miR-608	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2306603	hsa-miR-3607-5p	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2306604	hsa-miR-4453	CLIP-seq
MIRT2306605	hsa-miR-4501	CLIP-seq
MIRT2306606	hsa-miR-4504	CLIP-seq
MIRT2306607	hsa-miR-4538	CLIP-seq
MIRT2080457	hsa-miR-4659a-5p	CLIP-seq
MIRT2080458	hsa-miR-4659b-5p	CLIP-seq
MIRT2080459	hsa-miR-4722-3p	CLIP-seq
MIRT2080460	hsa-miR-4763-5p	CLIP-seq
MIRT2080461	hsa-miR-4769-3p	CLIP-seq
MIRT2306608	hsa-miR-542-3p	CLIP-seq
MIRT2306609	hsa-miR-659	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2080456	hsa-miR-4651	CLIP-seq
MIRT2080462	hsa-miR-491-5p	CLIP-seq
MIRT2080466	hsa-miR-608	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2604308	hsa-miR-1225-3p	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2604309	hsa-miR-1321	CLIP-seq
MIRT2604310	hsa-miR-15a	CLIP-seq
MIRT2604311	hsa-miR-15b	CLIP-seq
MIRT2604312	hsa-miR-16	CLIP-seq
MIRT2604313	hsa-miR-195	CLIP-seq
MIRT2604314	hsa-miR-2355-5p	CLIP-seq
MIRT2604315	hsa-miR-3125	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT2604316	hsa-miR-3162-5p	CLIP-seq
MIRT2604317	hsa-miR-3200-5p	CLIP-seq
MIRT2604318	hsa-miR-3202	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2604319	hsa-miR-3616-3p	CLIP-seq
MIRT2604320	hsa-miR-3619-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2604321	hsa-miR-3916	CLIP-seq
MIRT2604322	hsa-miR-3921	CLIP-seq
MIRT2604323	hsa-miR-3943	CLIP-seq
MIRT2604324	hsa-miR-424	CLIP-seq
MIRT2604325	hsa-miR-4268	CLIP-seq
MIRT2604326	hsa-miR-4274	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2604327	hsa-miR-4303	CLIP-seq
MIRT2604328	hsa-miR-4313	CLIP-seq
MIRT2604329	hsa-miR-4435	CLIP-seq
MIRT2306604	hsa-miR-4453	CLIP-seq
MIRT2604330	hsa-miR-4475	CLIP-seq
MIRT2604331	hsa-miR-4476	CLIP-seq
MIRT2604332	hsa-miR-4519	CLIP-seq
MIRT2306607	hsa-miR-4538	CLIP-seq
MIRT2604333	hsa-miR-4645-5p	CLIP-seq
MIRT2604334	hsa-miR-4649-3p	CLIP-seq
MIRT2604335	hsa-miR-4653-5p	CLIP-seq
MIRT2604336	hsa-miR-4671-5p	CLIP-seq
MIRT2604337	hsa-miR-4673	CLIP-seq
MIRT2604338	hsa-miR-4711-5p	CLIP-seq
MIRT2604339	hsa-miR-4721	CLIP-seq
MIRT2604340	hsa-miR-4739	CLIP-seq
MIRT2604341	hsa-miR-4755-3p	CLIP-seq
MIRT2604342	hsa-miR-4756-5p	CLIP-seq
MIRT2604343	hsa-miR-4776-5p	CLIP-seq
MIRT2604344	hsa-miR-497	CLIP-seq
MIRT2306609	hsa-miR-659	CLIP-seq
MIRT2604345	hsa-miR-665	CLIP-seq
MIRT2604346	hsa-miR-942	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2604308	hsa-miR-1225-3p	CLIP-seq
MIRT2604309	hsa-miR-1321	CLIP-seq
MIRT2604310	hsa-miR-15a	CLIP-seq
MIRT2604311	hsa-miR-15b	CLIP-seq
MIRT2604312	hsa-miR-16	CLIP-seq
MIRT2604313	hsa-miR-195	CLIP-seq
MIRT2689055	hsa-miR-198	CLIP-seq
MIRT2604314	hsa-miR-2355-5p	CLIP-seq
MIRT2604316	hsa-miR-3162-5p	CLIP-seq
MIRT2604317	hsa-miR-3200-5p	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2604319	hsa-miR-3616-3p	CLIP-seq
MIRT2604320	hsa-miR-3619-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2604322	hsa-miR-3921	CLIP-seq
MIRT2604323	hsa-miR-3943	CLIP-seq
MIRT2604324	hsa-miR-424	CLIP-seq
MIRT2689056	hsa-miR-4267	CLIP-seq
MIRT2604325	hsa-miR-4268	CLIP-seq
MIRT2604326	hsa-miR-4274	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2604327	hsa-miR-4303	CLIP-seq
MIRT2604328	hsa-miR-4313	CLIP-seq
MIRT2604329	hsa-miR-4435	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2604330	hsa-miR-4475	CLIP-seq
MIRT2604332	hsa-miR-4519	CLIP-seq
MIRT2604333	hsa-miR-4645-5p	CLIP-seq
MIRT2604334	hsa-miR-4649-3p	CLIP-seq
MIRT2604335	hsa-miR-4653-5p	CLIP-seq
MIRT2604337	hsa-miR-4673	CLIP-seq
MIRT2604338	hsa-miR-4711-5p	CLIP-seq
MIRT2604339	hsa-miR-4721	CLIP-seq
MIRT2604340	hsa-miR-4739	CLIP-seq
MIRT2604341	hsa-miR-4755-3p	CLIP-seq
MIRT2604342	hsa-miR-4756-5p	CLIP-seq
MIRT2604343	hsa-miR-4776-5p	CLIP-seq
MIRT2604344	hsa-miR-497	CLIP-seq
MIRT2604345	hsa-miR-665	CLIP-seq
MIRT2604346	hsa-miR-942	CLIP-seq

Show/Hide all(131)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0001525	Process	Angiogenesis	IBA	21873635
GO:0001556	Process	Oocyte maturation	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IMP	18765415
GO:0002040	Process	Sprouting angiogenesis	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002315	Process	Marginal zone B cell differentiation	ISS
GO:0004683	Function	Calmodulin-dependent protein kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	IBA	21873635
GO:0004713	Function	Protein tyrosine kinase activity	TAS	8939945
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	7544443, 10518561
GO:0004972	Function	NMDA glutamate receptor activity	ISS
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	8849729, 9020138, 10521452, 10867021, 11149930, 15661758, 18086875, 19086031, 21357692, 31413325, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	19880522
GO:0005737	Component	Cytoplasm	TAS	7499242
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005925	Component	Focal adhesion	IBA	21873635
GO:0005925	Component	Focal adhesion	IDA	18765415
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	TAS	7529876
GO:0006915	Process	Apoptotic process	TAS	10880513
GO:0006968	Process	Cellular defense response	ISS
GO:0006970	Process	Response to osmotic stress	IEA
GO:0007165	Process	Signal transduction	TAS	7499242, 10867021
GO:0007166	Process	Cell surface receptor signaling pathway	IMP	8849729
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007172	Process	Signal complex assembly	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	15050747
GO:0008022	Function	Protein C-terminus binding	IMP	10022914
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18765415
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	15050747
GO:0008360	Process	Regulation of cell shape	IMP	19086031
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009725	Process	Response to hormone	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010226	Process	Response to lithium ion	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	21245381
GO:0010656	Process	Negative regulation of muscle cell apoptotic process	IEA
GO:0010752	Process	Regulation of cGMP-mediated signaling	IEA
GO:0010758	Process	Regulation of macrophage chemotaxis	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0014009	Process	Glial cell proliferation	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0014069	Component	Postsynaptic density	TAS	25707991
GO:0017146	Component	NMDA selective glutamate receptor complex	ISS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	7544443
GO:0030027	Component	Lamellipodium	IDA	18765415
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030155	Process	Regulation of cell adhesion	IBA	21873635
GO:0030155	Process	Regulation of cell adhesion	IMP	19086031
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	18765415
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	ISS
GO:0030502	Process	Negative regulation of bone mineralization	ISS
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	18765415
GO:0031175	Process	Neuron projection development	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032960	Process	Regulation of inositol trisphosphate biosynthetic process	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	8670418
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	ISS
GO:0035902	Process	Response to immobilization stress	IEA
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	9545257, 10518561
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	ISS
GO:0038110	Process	Interleukin-2-mediated signaling pathway	TAS
GO:0042220	Process	Response to cocaine	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042976	Process	Activation of Janus kinase activity	IMP	8670418
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19880522
GO:0043149	Process	Stress fiber assembly	IEA
GO:0043197	Component	Dendritic spine	IBA	21873635
GO:0043267	Process	Negative regulation of potassium ion transport	IDA	7544443
GO:0043423	Function	3-phosphoinositide-dependent protein kinase binding	IEA
GO:0043507	Process	Positive regulation of JUN kinase activity	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043534	Process	Blood vessel endothelial cell migration	IEA
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	ISS
GO:0044297	Component	Cell body	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045121	Component	Membrane raft	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045453	Process	Bone resorption	ISS
GO:0045471	Process	Response to ethanol	IEA
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IMP	15050747
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IMP	7544443
GO:0046330	Process	Positive regulation of JNK cascade	IMP	8670418
GO:0046777	Process	Protein autophosphorylation	TAS	8849729
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	21245381
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0048167	Process	Regulation of synaptic plasticity	TAS	25707991
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18765415
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	10022914, 10518561, 21245381
GO:0050848	Process	Regulation of calcium-mediated signaling	IEA
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	ISS
GO:0051591	Process	Response to cAMP	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	10867021
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	7544443
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IMP	19086031
GO:0090630	Process	Activation of GTPase activity	IEA
GO:0097440	Component	Apical dendrite	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:2000058	Process	Regulation of ubiquitin-dependent protein catabolic process	IDA	19880522
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	ISS
GO:2000249	Process	Regulation of actin cytoskeleton reorganization	ISS
GO:2000310	Process	Regulation of NMDA receptor activity	ISS
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	ISS
GO:2000538	Process	Positive regulation of B cell chemotaxis	ISS
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
601212	9612	ENSG00000120899

Protein

UniProt ID

Q14289

Protein name

Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine

Protein function

Non-receptor protein-tyrosine kinase that regulates reorganization of the actin cytoskeleton, cell polarization, cell migration, adhesion, spreading and bone remodeling. Plays a role in the regulation of the humoral immune response, and is requi

PDB

2LK4 , 3CC6 , 3ET7 , 3FZO , 3FZP , 3FZR , 3FZS , 3FZT , 3GM1 , 3GM2 , 3GM3 , 3H3C , 3U3F , 4EKU , 4H1J , 4H1M , 4R32 , 4XEF , 4XEK , 4XEV , 5TO8 , 5TOB , 6LF3 , 7PLL , 8XOX , 8YGX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18038	FERM_N_2	39 → 137	FERM N-terminal domain	Domain
PF00373	FERM_M	141 → 265	FERM central domain	Domain
PF07714	PK_Tyr_Ser-Thr	425 → 679	Protein tyrosine and serine/threonine kinase	Domain
PF03623	Focal_AT	870 → 1002	Focal adhesion targeting region	Domain

Tissue specificity

TISSUE SPECIFICITY: Most abundant in the brain, with highest levels in amygdala and hippocampus. Low levels in kidney (at protein level). Also expressed in spleen and lymphocytes. {ECO:0000269|PubMed:7544443, ECO:0000269|PubMed:9545257}.

Sequence

MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

Sequence length

1009

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Chemokine signaling pathway Phospholipase D signaling pathway Natural killer cell mediated cytotoxicity Leukocyte transendothelial migration GnRH signaling pathway Yersinia infection Hepatitis B Human cytomegalovirus infection Human immunodeficiency virus 1 infection		Signal regulatory protein family interactions VEGFA-VEGFR2 Pathway Interleukin-2 signaling

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	24162737, 30617256, 31473137, 29777097
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	26192919
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	19718025

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Source
Unknown
Neuroticism	Neuroticism	GWAS
Takayasu Arteritis	Takayasu Arteritis	GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease	GWAS
Crohn Disease	Crohn Disease	GWAS
Oligodendroglioma	Oligodendroglioma	GWAS
Schizophrenia	Schizophrenia	GWAS

Show/Hide Text Mining Associations (161)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Threatened	Associate	32775426
Adenocarcinoma	Associate	17849461
Adenocarcinoma of Lung	Associate	22372491, 29272003, 36919755
Adenomyosis	Associate	30365102
Adenosarcoma of the uterus	Associate	28690098
Adrenal Gland Neoplasms	Associate	23626817
Alveolar capillary dysplasia	Associate	38029923
Alzheimer Disease	Associate	25114068, 26625115, 26680604, 28199971, 28650998, 30286791, 30297968, 30611996, 32192109, 33419465
Ameloblastoma	Associate	32719259
Amyotrophic Lateral Sclerosis	Associate	21228060
Anemia Aplastic	Stimulate	36334505
Aortic Aneurysm Abdominal	Associate	25993291
Arthritis Rheumatoid	Associate	17963503
Ascites	Associate	25080058, 27613122
Ataxia Telangiectasia	Associate	19152963
Atrial Fibrillation	Associate	33747117
Autoimmune Diseases	Associate	21828127
Bipolar Disorder	Associate	19051289, 29484683
Blister	Associate	34924185
Breast Neoplasms	Associate	10441522, 15475931, 16457699, 16619501, 17299391, 17545584, 21278786, 25099615, 25648557, 25744065, 25928145, 26026468, 27081168, 27391337, 28198505 View all (11 more)
Calcinosis Cutis	Associate	12950263
Carcinogenesis	Associate	15353558, 23626817, 30536312
Carcinoma Basal Cell	Associate	27367190, 29920512, 36788083
Carcinoma Hepatocellular	Associate	12918102, 17609269, 21533080, 22583868, 25741595, 26109807, 28347229, 29749446, 29992971, 31860631, 32271415, 34639072, 34708625, 35132819, 35383533, 35412944 View all (1 more)
Carcinoma Mucoepidermoid	Associate	29419396
Carcinoma Non Small Cell Lung	Associate	21722267, 23922106, 24659658, 30535430, 32945500, 36876724, 38067530, 38583438
Carcinoma Ovarian Epithelial	Associate	37276925
Carcinoma Pancreatic Ductal	Associate	34771150, 35457111
Carcinoma Renal Cell	Associate	23139422, 25757764, 26790128
Cardiomyopathies	Associate	25137373
Cardiomyopathy Dilated	Associate	25137373
Cardiomyopathy Hypertrophic	Associate	12796566
Cardiomyopathy Restrictive	Associate	26931105
Cardiotoxicity	Associate	33474949
Cartilage Diseases	Associate	32322000
Cerebral Hemorrhage	Associate	36169245
Cerebral Infarction	Associate	31894261
Chemical and Drug Induced Liver Injury	Associate	25080058
Colonic Diseases	Associate	33082554
Colorectal Neoplasms	Associate	12115344, 27350731, 27716613, 28990068, 29257307, 30025541, 30365116, 32000660, 35294319, 35586809, 36302536
Complex Regional Pain Syndromes	Associate	31217010
COVID 19	Associate	33073699, 34941025
Diabetes Gestational	Associate	24507683, 38497391
Diabetes Mellitus Type 2	Associate	20943749, 30544451
Diabetic Nephropathies	Associate	38374020
Disseminated Intravascular Coagulation	Associate	22842493
Drug Related Side Effects and Adverse Reactions	Associate	14762343
Endocrine System Diseases	Associate	24467828
Endometrial Neoplasms	Associate	25640355, 29595187, 31863623
Endometriosis	Associate	19074548
Esophageal Neoplasms	Associate	22919244, 30942438
Esophageal Squamous Cell Carcinoma	Associate	29463194
Fatty Liver	Associate	36083487
Fever	Inhibit	33537819
Gallbladder Neoplasms	Associate	32925281
Ganglioglioma	Associate	24374956
Gastro enteropancreatic neuroendocrine tumor	Associate	36269546
Glaucoma	Associate	31680442
Glioblastoma	Associate	12468535, 14655756, 16740698, 21602932, 22497886, 32705169, 34614303, 35087132
Glioma	Associate	15720813, 16723503, 22745829, 24395351, 25433371, 26151295, 30296359, 35862252, 36204885
Glucosephosphate Dehydrogenase Deficiency	Associate	29963728
Glycosuria Renal	Associate	36698245
Graft vs Host Disease	Associate	33082554
Head and Neck Neoplasms	Associate	23115635
Hematologic Diseases	Associate	23642027
Hyperoxia	Stimulate	34911614
Hypertension	Associate	14611643, 36862882
Hypoxia	Associate	12495471, 19473970, 25889845
Hypoxia Brain	Associate	23778527
Idiopathic Noncirrhotic Portal Hypertension	Associate	25080058
Infections	Associate	26109718
Inflammation	Associate	12515814, 18204201, 21828127, 22842493, 28498330, 35451408, 36031486, 36797040, 38178680, 40191870
Inflammatory Bowel Diseases	Associate	33660567
Insulin Resistance	Associate	18160431, 22403297, 24507683, 29207074, 31389668, 37409718
Kidney Failure Chronic	Inhibit	38382928
Laryngeal Neoplasms	Associate	38134081
Leukemia	Associate	22207684, 23828551, 35440579, 9949179
Leukemia	Inhibit	23393162
Leukemia Large Granular Lymphocytic	Associate	19880494
Leukemia Lymphocytic Chronic B Cell	Associate	12393602, 15728130
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10974024, 14961028, 23642027
Leukemia Myeloid Acute	Associate	23393162, 24850755, 27531894, 33592500, 37038247
Liver Failure	Associate	25080058, 35132819
Lung Injury	Associate	34911614
Lung Neoplasms	Associate	18507841, 22581436, 23922106, 24659658, 24938479
Lupus Erythematosus Systemic	Stimulate	19919693
Lupus Erythematosus Systemic	Associate	19930834
Lupus Nephritis	Stimulate	19930834
Lymphatic Metastasis	Associate	25648557
Lymphoma	Associate	23603894, 35440579
Lymphoma Large B Cell Diffuse	Associate	23840064
Medulloblastoma	Associate	17039417, 22212915
Melanoma	Associate	22475322
Metabolic Diseases	Associate	20943749
Mevalonate Kinase Deficiency	Associate	18684863, 25107911
Mohr Tranebjaerg syndrome	Associate	24108762
Multiple Myeloma	Associate	10880513, 18515658, 36053135, 36322819
Multiple Sclerosis	Associate	24155968
Muscular Dystrophy Emery Dreifuss	Associate	36657019
Myelodysplastic Syndromes	Associate	19644139
Myocardial Infarction	Stimulate	34275376
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	33242826
Nasopharyngeal Carcinoma	Associate	31634779, 35196205
Neoplasm Metastasis	Associate	12950263, 23626817, 23730900, 24154688, 32225123
Neoplasm Metastasis	Stimulate	33785524
Neoplasms	Associate	10716737, 11278548, 11477064, 12115344, 14655756, 14762343, 15150572, 15304161, 16457699, 16619521, 17609269, 18687633, 19814803, 19925030, 20572035 View all (32 more)
Neoplasms	Inhibit	22395469, 27649143, 33785524
Neoplasms	Stimulate	27716613
Neoplasms Glandular and Epithelial	Associate	34898367
Nephritis	Associate	19919693
Nephrolithiasis Calcium Oxalate	Associate	40191870
Neural Tube Defects	Associate	17898317
Neuroblastoma	Associate	19211844, 30020827
Neuroma Acoustic	Associate	20856158
Non alcoholic Fatty Liver Disease	Associate	20888662
Norrie disease	Associate	17963503
Organizing Pneumonia	Associate	19930834
Osteoarthritis	Associate	17963503, 37058031, 37788787
Osteoarthritis Knee	Associate	22532149
Osteoglophonic dwarfism	Associate	32124937
Osteoporosis	Associate	19244237, 40080935
Osteoporosis	Stimulate	37874452
Osteosarcoma	Associate	22994717, 32901863, 34884541, 34903122
Ovarian Diseases	Associate	38321265
Ovarian Neoplasms	Associate	23013730, 24523919, 27613122, 30523211, 31957818, 32373947, 34727985, 36335987
Pancreatic Neoplasms	Associate	12495471, 38521069
Parkinson Disease	Associate	30640362
Periodontitis	Associate	34213019
Personality Disorders	Associate	34087900
Pheochromocytoma	Associate	23626817
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24367274
Prostatic Hyperplasia	Associate	11204274
Prostatic Neoplasms	Associate	11204274, 11461904, 14985354, 17329398, 18959755, 19106639, 35387563, 35908886, 37501932, 38048859
Prostatic Neoplasms Castration Resistant	Associate	35834137
Proteinuria	Associate	22218591
Pulmonary Disease Chronic Obstructive	Associate	38178680
Pulmonary Veno Occlusive Disease	Associate	36400028
Purpura Thrombocytopenic Idiopathic	Associate	38184203
Reperfusion Injury	Associate	39341981
Respiratory Tract Infections	Associate	32225123
Retinitis	Associate	38085518
Retinoblastoma	Associate	32323827
Sarcoma Kaposi	Associate	9621077
Schizophrenia	Associate	19051289
Scleroderma Systemic	Associate	17524560, 29720235
Shock Septic	Associate	37359526
Squamous Cell Carcinoma of Head and Neck	Associate	23730900, 25405202, 29039443, 31115008
Stomach Neoplasms	Associate	19238332, 20428959, 23321169, 25099615, 25338767, 30274346, 30591093, 31786865, 36438913, 37415737, 40082221
Stomach Neoplasms	Stimulate	37953442
Takayasu Arteritis	Associate	25604533, 30498034
Tauopathies	Associate	33419465
Telangiectasia Hereditary Hemorrhagic	Associate	35456471
Thyroid Cancer Papillary	Associate	31646573, 31696481
Thyroid Neoplasms	Associate	32812852, 34911834
Triple Negative Breast Neoplasms	Associate	29920512, 30250159, 37657065
Urinary Bladder Neoplasms	Associate	21523767, 22486221, 29665744
Uterine Cervical Neoplasms	Associate	29516642, 34858519, 35616137, 35791307, 36253980, 36606668
Vascular Diseases	Associate	22842493
Vasculitis	Associate	34961976, 36797040
Venous Thrombosis	Associate	37391801
Vitiligo	Associate	24410795, 31941556

PTK2B (protein tyrosine kinase 2 beta)