Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	2185
Gene name	Protein tyrosine kinase 2 beta
Gene symbol	PTK2B
Synonyms (NCBI Gene)	CADTKCAKBFADK2FAK2PKBPTKPYK2RAFTK
Chromosome	8
Chromosome location	8p21.2
Summary	This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuro

181

Show/Hide all (181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006963	hsa-miR-23b-3p	Immunoblot	22745829
MIRT018928	hsa-miR-335-5p	Microarray	18185580
MIRT438433	hsa-miR-517a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23142219
MIRT438432	hsa-miR-517c-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23142219
MIRT438433	hsa-miR-517a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23142219
MIRT438432	hsa-miR-517c-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23142219
MIRT716875	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT716874	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT716873	hsa-miR-940	HITS-CLIP	19536157
MIRT716871	hsa-miR-4514	HITS-CLIP	19536157
MIRT716872	hsa-miR-4692	HITS-CLIP	19536157
MIRT716870	hsa-miR-3665	HITS-CLIP	19536157
MIRT716869	hsa-miR-4736	HITS-CLIP	19536157
MIRT006963	hsa-miR-23b-3p	Luciferase reporter assayqRT-PCRWestern blot	28262617
MIRT006963	hsa-miR-23b-3p	Luciferase reporter assayqRT-PCRWestern blot	28262617
MIRT716875	hsa-miR-6808-5p	HITS-CLIP	19536157
MIRT716874	hsa-miR-6893-5p	HITS-CLIP	19536157
MIRT716873	hsa-miR-940	HITS-CLIP	19536157
MIRT716871	hsa-miR-4514	HITS-CLIP	19536157
MIRT716872	hsa-miR-4692	HITS-CLIP	19536157
MIRT716870	hsa-miR-3665	HITS-CLIP	19536157
MIRT716869	hsa-miR-4736	HITS-CLIP	19536157
MIRT1273554	hsa-miR-3189-5p	CLIP-seq
MIRT1273555	hsa-miR-3664-3p	CLIP-seq
MIRT1273556	hsa-miR-4433	CLIP-seq
MIRT1273557	hsa-miR-4459	CLIP-seq
MIRT1273558	hsa-miR-4469	CLIP-seq
MIRT1273559	hsa-miR-4726-3p	CLIP-seq
MIRT1273560	hsa-miR-4758-3p	CLIP-seq
MIRT1273561	hsa-miR-4768-3p	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT1273563	hsa-miR-548a-5p	CLIP-seq
MIRT1273564	hsa-miR-548ab	CLIP-seq
MIRT1273565	hsa-miR-548ak	CLIP-seq
MIRT1273566	hsa-miR-548b-5p	CLIP-seq
MIRT1273567	hsa-miR-548c-5p	CLIP-seq
MIRT1273568	hsa-miR-548d-5p	CLIP-seq
MIRT1273569	hsa-miR-548h	CLIP-seq
MIRT1273570	hsa-miR-548i	CLIP-seq
MIRT1273571	hsa-miR-548j	CLIP-seq
MIRT1273572	hsa-miR-548w	CLIP-seq
MIRT1273573	hsa-miR-548y	CLIP-seq
MIRT1273574	hsa-miR-559	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2080456	hsa-miR-4651	CLIP-seq
MIRT2080457	hsa-miR-4659a-5p	CLIP-seq
MIRT2080458	hsa-miR-4659b-5p	CLIP-seq
MIRT2080459	hsa-miR-4722-3p	CLIP-seq
MIRT2080460	hsa-miR-4763-5p	CLIP-seq
MIRT2080461	hsa-miR-4769-3p	CLIP-seq
MIRT2080462	hsa-miR-491-5p	CLIP-seq
MIRT2080463	hsa-miR-517a	CLIP-seq
MIRT2080464	hsa-miR-517b	CLIP-seq
MIRT2080465	hsa-miR-517c	CLIP-seq
MIRT2080466	hsa-miR-608	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2306603	hsa-miR-3607-5p	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2306604	hsa-miR-4453	CLIP-seq
MIRT2306605	hsa-miR-4501	CLIP-seq
MIRT2306606	hsa-miR-4504	CLIP-seq
MIRT2306607	hsa-miR-4538	CLIP-seq
MIRT2080457	hsa-miR-4659a-5p	CLIP-seq
MIRT2080458	hsa-miR-4659b-5p	CLIP-seq
MIRT2080459	hsa-miR-4722-3p	CLIP-seq
MIRT2080460	hsa-miR-4763-5p	CLIP-seq
MIRT2080461	hsa-miR-4769-3p	CLIP-seq
MIRT2306608	hsa-miR-542-3p	CLIP-seq
MIRT2306609	hsa-miR-659	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2080451	hsa-miR-3150a-3p	CLIP-seq
MIRT2080452	hsa-miR-3175	CLIP-seq
MIRT2080456	hsa-miR-4651	CLIP-seq
MIRT2080462	hsa-miR-491-5p	CLIP-seq
MIRT2080466	hsa-miR-608	CLIP-seq
MIRT2080467	hsa-miR-939	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2604308	hsa-miR-1225-3p	CLIP-seq
MIRT2080450	hsa-miR-1234	CLIP-seq
MIRT2604309	hsa-miR-1321	CLIP-seq
MIRT2604310	hsa-miR-15a	CLIP-seq
MIRT2604311	hsa-miR-15b	CLIP-seq
MIRT2604312	hsa-miR-16	CLIP-seq
MIRT2604313	hsa-miR-195	CLIP-seq
MIRT2604314	hsa-miR-2355-5p	CLIP-seq
MIRT2604315	hsa-miR-3125	CLIP-seq
MIRT1273562	hsa-miR-3153	CLIP-seq
MIRT2604316	hsa-miR-3162-5p	CLIP-seq
MIRT2604317	hsa-miR-3200-5p	CLIP-seq
MIRT2604318	hsa-miR-3202	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2604319	hsa-miR-3616-3p	CLIP-seq
MIRT2604320	hsa-miR-3619-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2604321	hsa-miR-3916	CLIP-seq
MIRT2604322	hsa-miR-3921	CLIP-seq
MIRT2604323	hsa-miR-3943	CLIP-seq
MIRT2604324	hsa-miR-424	CLIP-seq
MIRT2604325	hsa-miR-4268	CLIP-seq
MIRT2604326	hsa-miR-4274	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2604327	hsa-miR-4303	CLIP-seq
MIRT2604328	hsa-miR-4313	CLIP-seq
MIRT2604329	hsa-miR-4435	CLIP-seq
MIRT2306604	hsa-miR-4453	CLIP-seq
MIRT2604330	hsa-miR-4475	CLIP-seq
MIRT2604331	hsa-miR-4476	CLIP-seq
MIRT2604332	hsa-miR-4519	CLIP-seq
MIRT2306607	hsa-miR-4538	CLIP-seq
MIRT2604333	hsa-miR-4645-5p	CLIP-seq
MIRT2604334	hsa-miR-4649-3p	CLIP-seq
MIRT2604335	hsa-miR-4653-5p	CLIP-seq
MIRT2604336	hsa-miR-4671-5p	CLIP-seq
MIRT2604337	hsa-miR-4673	CLIP-seq
MIRT2604338	hsa-miR-4711-5p	CLIP-seq
MIRT2604339	hsa-miR-4721	CLIP-seq
MIRT2604340	hsa-miR-4739	CLIP-seq
MIRT2604341	hsa-miR-4755-3p	CLIP-seq
MIRT2604342	hsa-miR-4756-5p	CLIP-seq
MIRT2604343	hsa-miR-4776-5p	CLIP-seq
MIRT2604344	hsa-miR-497	CLIP-seq
MIRT2306609	hsa-miR-659	CLIP-seq
MIRT2604345	hsa-miR-665	CLIP-seq
MIRT2604346	hsa-miR-942	CLIP-seq
MIRT2439702	hsa-miR-1184	CLIP-seq
MIRT2604308	hsa-miR-1225-3p	CLIP-seq
MIRT2604309	hsa-miR-1321	CLIP-seq
MIRT2604310	hsa-miR-15a	CLIP-seq
MIRT2604311	hsa-miR-15b	CLIP-seq
MIRT2604312	hsa-miR-16	CLIP-seq
MIRT2604313	hsa-miR-195	CLIP-seq
MIRT2689055	hsa-miR-198	CLIP-seq
MIRT2604314	hsa-miR-2355-5p	CLIP-seq
MIRT2604316	hsa-miR-3162-5p	CLIP-seq
MIRT2604317	hsa-miR-3200-5p	CLIP-seq
MIRT2080453	hsa-miR-361-3p	CLIP-seq
MIRT2604319	hsa-miR-3616-3p	CLIP-seq
MIRT2604320	hsa-miR-3619-3p	CLIP-seq
MIRT2080454	hsa-miR-3677-5p	CLIP-seq
MIRT2604322	hsa-miR-3921	CLIP-seq
MIRT2604323	hsa-miR-3943	CLIP-seq
MIRT2604324	hsa-miR-424	CLIP-seq
MIRT2689056	hsa-miR-4267	CLIP-seq
MIRT2604325	hsa-miR-4268	CLIP-seq
MIRT2604326	hsa-miR-4274	CLIP-seq
MIRT2080455	hsa-miR-4286	CLIP-seq
MIRT2439703	hsa-miR-4293	CLIP-seq
MIRT2604327	hsa-miR-4303	CLIP-seq
MIRT2604328	hsa-miR-4313	CLIP-seq
MIRT2604329	hsa-miR-4435	CLIP-seq
MIRT2439704	hsa-miR-4468	CLIP-seq
MIRT2604330	hsa-miR-4475	CLIP-seq
MIRT2604332	hsa-miR-4519	CLIP-seq
MIRT2604333	hsa-miR-4645-5p	CLIP-seq
MIRT2604334	hsa-miR-4649-3p	CLIP-seq
MIRT2604335	hsa-miR-4653-5p	CLIP-seq
MIRT2604337	hsa-miR-4673	CLIP-seq
MIRT2604338	hsa-miR-4711-5p	CLIP-seq
MIRT2604339	hsa-miR-4721	CLIP-seq
MIRT2604340	hsa-miR-4739	CLIP-seq
MIRT2604341	hsa-miR-4755-3p	CLIP-seq
MIRT2604342	hsa-miR-4756-5p	CLIP-seq
MIRT2604343	hsa-miR-4776-5p	CLIP-seq
MIRT2604344	hsa-miR-497	CLIP-seq
MIRT2604345	hsa-miR-665	CLIP-seq
MIRT2604346	hsa-miR-942	CLIP-seq

132

Show/Hide all (132)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001952	Process	Regulation of cell-matrix adhesion	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IMP	18765415
GO:0002040	Process	Sprouting angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002315	Process	Marginal zone B cell differentiation	IEA
GO:0002315	Process	Marginal zone B cell differentiation	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004683	Function	Calcium/calmodulin-dependent protein kinase activity	ISS
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	8939945
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	7544443, 10518561
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	ISS
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	8497321
GO:0005515	Function	Protein binding	IPI	8849729, 9020138, 10022914, 10521452, 10867021, 11149930, 15661758, 18086875, 19086031, 21357692, 31413325, 32707033, 32814053, 36931259, 38844957
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	19880522
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	7499242
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	18765415
GO:0005925	Component	Focal adhesion	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	TAS	7529876
GO:0006915	Process	Apoptotic process	TAS	10880513
GO:0006968	Process	Cellular defense response	ISS
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007030	Process	Golgi organization	IEA
GO:0007165	Process	Signal transduction	TAS	7499242, 10867021
GO:0007166	Process	Cell surface receptor signaling pathway	IMP	8849729
GO:0007172	Process	Signal complex assembly	IEA
GO:0007172	Process	Signal complex assembly	TAS	7529876
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	15050747
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18765415
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10867021
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	15050747
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	19086031
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	21245381
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010758	Process	Regulation of macrophage chemotaxis	IEA
GO:0010758	Process	Regulation of macrophage chemotaxis	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0014069	Component	Postsynaptic density	ISS
GO:0014069	Component	Postsynaptic density	TAS	25707991
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017146	Component	NMDA selective glutamate receptor complex	ISS
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	7544443
GO:0030027	Component	Lamellipodium	IDA	18765415
GO:0030027	Component	Lamellipodium	IEA
GO:0030054	Component	Cell junction	IEA
GO:0030155	Process	Regulation of cell adhesion	IBA
GO:0030155	Process	Regulation of cell adhesion	IMP	19086031
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	18765415
GO:0030425	Component	Dendrite	ISS
GO:0030426	Component	Growth cone	ISS
GO:0030502	Process	Negative regulation of bone mineralization	IEA
GO:0030502	Process	Negative regulation of bone mineralization	ISS
GO:0030546	Function	Signaling receptor activator activity	ISS
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	18765415
GO:0030865	Process	Cortical cytoskeleton organization	IEA
GO:0030865	Process	Cortical cytoskeleton organization	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	8670418
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	ISS
GO:0035255	Function	Ionotropic glutamate receptor binding	ISS
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	9545257
GO:0042976	Process	Activation of Janus kinase activity	IMP	8670418
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19880522
GO:0043267	Process	Negative regulation of potassium ion transport	IDA	7544443
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0044297	Component	Cell body	ISS
GO:0045453	Process	Bone resorption	IEA
GO:0045453	Process	Bone resorption	ISS
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IMP	15050747
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IMP	7544443
GO:0046330	Process	Positive regulation of JNK cascade	IMP	8670418
GO:0046777	Process	Protein autophosphorylation	TAS	8849729
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	21245381
GO:0048167	Process	Regulation of synaptic plasticity	TAS	25707991
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18765415
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	ISS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0065003	Process	Protein-containing complex assembly	TAS	10867021
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	7544443
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0071498	Process	Cellular response to fluid shear stress	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IMP	19086031
GO:0097440	Component	Apical dendrite	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:0099151	Process	Regulation of postsynaptic density assembly	IEA
GO:0099602	Function	Neurotransmitter receptor regulator activity	ISS
GO:2000058	Process	Regulation of ubiquitin-dependent protein catabolic process	IDA	19880522
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	ISS
GO:2000538	Process	Positive regulation of B cell chemotaxis	IEA
GO:2000538	Process	Positive regulation of B cell chemotaxis	ISS

MIM	HGNC	e!Ensembl
601212	9612	ENSG00000120899

Q14289

Protein name

Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine

Protein function

Non-receptor protein-tyrosine kinase that regulates reorganization of the actin cytoskeleton, cell polarization, cell migration, adhesion, spreading and bone remodeling. Plays a role in the regulation of the humoral immune response, and is requi

PDB

2LK4 , 3CC6 , 3ET7 , 3FZO , 3FZP , 3FZR , 3FZS , 3FZT , 3GM1 , 3GM2 , 3GM3 , 3H3C , 3U3F , 4EKU , 4H1J , 4H1M , 4R32 , 4XEF , 4XEK , 4XEV , 5TO8 , 5TOB , 6LF3 , 7PLL , 8XOX , 8YGX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18038	FERM_N_2	39 → 137	FERM N-terminal domain	Domain
PF00373	FERM_M	141 → 265	FERM central domain	Domain
PF07714	PK_Tyr_Ser-Thr	425 → 679	Protein tyrosine and serine/threonine kinase	Domain
PF03623	Focal_AT	870 → 1002	Focal adhesion targeting region	Domain

Tissue specificity

TISSUE SPECIFICITY: Most abundant in the brain, with highest levels in amygdala and hippocampus. Low levels in kidney (at protein level). Also expressed in spleen and lymphocytes. {ECO:0000269|PubMed:7544443, ECO:0000269|PubMed:9545257}.

Sequence

MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

Sequence length

1009

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Chemokine signaling pathway Phospholipase D signaling pathway Natural killer cell mediated cytotoxicity Leukocyte transendothelial migration GnRH signaling pathway Yersinia infection Hepatitis B Human cytomegalovirus infection Human immunodeficiency virus 1 infection		Signal regulatory protein family interactions VEGFA-VEGFR2 Pathway Interleukin-2 signaling

PTK2B (protein tyrosine kinase 2 beta)