Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2178
Gene name Gene Name - the full gene name approved by the HGNC.
FA complementation group E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FANCE
Synonyms (NCBI Gene) Gene synonyms aliases
FACE, FAE
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121434505 C>T Pathogenic Non coding transcript variant, stop gained, coding sequence variant
rs121434506 C>A,T Pathogenic Non coding transcript variant, stop gained, coding sequence variant, synonymous variant
rs587778337 C>-,CC Not-provided, pathogenic Non coding transcript variant, intron variant, frameshift variant, coding sequence variant
rs754850404 G>- Likely-pathogenic Initiator codon variant, coding sequence variant, non coding transcript variant, frameshift variant
rs763151358 C>T Likely-pathogenic, uncertain-significance Missense variant, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016378 hsa-miR-193b-3p Microarray 20304954
MIRT756240 hsa-miR-26a-5p Luciferase reporter assay, Western blotting, qRT-PCR 34804856
MIRT989060 hsa-miR-1254 CLIP-seq
MIRT989061 hsa-miR-1255a CLIP-seq
MIRT989062 hsa-miR-1255b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 22343915
GO:0001541 Process Ovarian follicle development IEA
GO:0005515 Function Protein binding IPI 12649160, 33961781, 35512704
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus NAS 11001585
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613976 3586 ENSG00000112039
Protein
UniProt ID Q9HB96
Protein name Fanconi anemia group E protein (Protein FACE)
Protein function As part of the Fanconi anemia (FA) complex functions in DNA cross-links repair. Required for the nuclear accumulation of FANCC and provides a critical bridge between the FA complex and FANCD2. {ECO:0000269|PubMed:12093742, ECO:0000269|PubMed:172
PDB 2ILR , 7KZP , 7KZQ , 7KZR , 7KZS , 7KZT , 7KZV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11510 FA_FANCE 274 535 Fanconi Anaemia group E protein FANCE Family
Sequence
MATPDAGLPGAEGVEPAPWAQLEAPARLLLQALQAGPEGARRGLGVLRALGSRGWEPFDW
GRLLEALCREEPVVQGPDGRLELKPLLLRLPRICQRNLMSLLMAVRPSLPESGLLSVLQI
AQQDLAPDPDAWLRALGELLRRDLGVGTSMEGASPLSERCQRQLQSLCRGLGLGGRRLKS
PQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDHEKERPEHKSLE
SLADGGSASPIKDQPVMAVKTGEDGSNLDDAKGLAESLELPKAIQDQLPRLQQLLKTLEE
GLEGLEDAPPVELQLLHECSPSQMDLLCAQLQLPQLSDLGLLRLCTWLLALSPDLSLSNA
TVLTRSLFLGRILSLTSSASRLLTTALTSFCAKYTYPVCSALLDPVLQAPGTGPAQTELL
CCLVKMESLEPDAQVLMLGQILELPWKEETFLVLQSLLERQVEMTPEKFSVLMEKLCKKG
LAATTSMAYAKLMLTVMTKYQANITETQRLGLAMALEPNTTFLRKSLKAALKHLG
P
Sequence length 536
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Fanconi anemia pathway   Fanconi Anemia Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Fanconi Anemia Fanconi anemia complementation group E, fanconi anemia rs878854342, rs587778337, rs754850404, rs775076977, rs773363446, rs1581696699, rs760150539, rs121434505, rs121434506 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Malignant tumor of breast N/A N/A ClinVar
Insomnia Insomnia N/A N/A GWAS
Microcephaly microcephaly N/A N/A ClinVar
ovarian cancer Ovarian cancer N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anemia Hemolytic Associate 17308347
Colorectal Neoplasms Associate 27165003
Esophageal Neoplasms Associate 21279724
Esophageal Squamous Cell Carcinoma Associate 21279724, 23504502
Fanconi Anemia Associate 11001585, 12239156, 15256425, 16127171, 17296736, 19405097, 21279724, 24451376, 27165003, 28678401
Head and Neck Neoplasms Associate 33592580
Hereditary Breast and Ovarian Cancer Syndrome Associate 27165003, 30306255
Hypogonadism Associate 33270637
Neoplasms Associate 28878254, 32778095, 33592580
Pancreatic Neoplasms Associate 39256447